KEGG   Streptococcus pneumoniae INV104: INV104_00560Help
Entry
INV104_00560      CDS       T02072                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sni00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sni00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70962..71999
Genome map
AA seq 345 aa AA seqDB search
MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAPDKAGNFANVILGFDD
FDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNCNHSGSTGWDSSLFEVE
EVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYKVTTDQDTLVNPTNHSYF
NLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVVKHVYNGTLLKDIFAEEDE
QIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPCFVVYTANFVDESVIIGGQP
MLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRYELVVK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatacacagagcgtgtatttggaaatgttgagggtgaggatgtcttggcctat
cgatttgagacagacggtggctaccaacttgaggttatgacttatggtgcgactatcttg
cgctatgtcgcacctgacaaggctggaaattttgccaatgttatcttgggatttgatgac
tttgatagttatgtaggcaatagtcccaagcatggagcaagtgtaggtcctgtagcgggt
cgtattgcaggtgcgacctttgagctcaatggtaagacctatgaccttgaggttaataat
gctagcaactgtaatcacagtggttcaactggttgggattccagcttgtttgaagttgaa
gaagtaagcgatcatggcttgactctctacacagagcgtacagatgggacaggagggttc
cctggaaatctcaagatttggatcagttatcacttggaagaaactggtgcctatgaaatc
agctacaaggtaacgaccgatcaggatacgctggtcaatccaaccaaccacagctatttc
aacttgtctggtgatttcacgcagacgattgaccgtcatgtcttccaactaaacacagag
ggcatttactcaatcgctcctgacggtgttcctgccaaaactccagaagccaaccgtgat
gtggtcaaacacgtctacaatggtaccttgttgaaggatatctttgcagaagaagatgag
caaatccagctggcatcaggtttggatcatccatttgcccttcctgcaggccatgacaat
gctggattcctttatgaccaaaattcaggtcgcttcctgcttttcaagacagaagctcct
tgctttgtggtctacacagcaaactttgtggatgaaagtgtcatcataggaggtcagcca
atgctacagcacaatgggattgctcttgaagcgcaagctttaccagatgccattcacagt
gaccttaaaggccaagtcattcttaaagctggtcaaaccttcaccagtaagacacgttat
gaacttgttgtgaaataa

DBGET integrated database retrieval system