KEGG   Streptococcus pneumoniae INV104: INV104_02420Help
Entry
INV104_02420      CDS       T02072                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sni01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sni00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sni00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sni00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261329..262348)
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GIGIVKEIAPDVKNLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAGLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctattgaagaaaaagtactc
cgtccacttgaaactggggaagcacttgtagaagttgaatactgtggcgtttgccacacc
gacctccacgttgctcatggtgactttggtcaagtcccaggacgtgttcttgggcacgaa
ggtatcggtatcgttaaagagattgctccagatgtgaaaaaccttaaagtcggtgaccgc
gtcagcgttgcttggttctttgaaggatgtggcacttgcgaatactgtacaactggtcgc
gaaaccctttgccgtacagtgaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgctgactatgctgtcaaagttcctgacggacttgatccagcccaa
gcttcttctatcacatgtgctggagtaacaacctataaagctatcaaagaagcaaaagtt
gaaccaggccaatgggttgttctttacggtgctggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgttatcgcagtcgatatcaacaatgacaaactt
gcccttgcaaaagaagtaggcgctgacattgtgattaacggcctcgaagttgaagatgta
gctggactcattaaagaaaaaactgatggaggagctcattcagctgtcgtaactgctgtg
tctaaagttgccttcaaccaggctgttgactccattcgtgctggtggtcgcgtcgtcgct
gttggtcttccttctgaaatgatggaactcagcatcgttaaaacagtcctcgatggaatc
caagtcatcggttctcttgtcggaactcgtaaagacttagaagaagccttccaatttggt
gcagaaggtctggtagtcccagttgttcaaaaacgtccagtagaagatgctgttgccatt
ttcgacgaaatggaaaaaggccaaatccaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system