KEGG   Streptococcus pneumoniae INV104: INV104_02420Help
Entry
INV104_02420      CDS       T02072                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
sni00010  Glycolysis / Gluconeogenesis
sni00625  Chloroalkane and chloroalkene degradation
sni00626  Naphthalene degradation
sni01100  Metabolic pathways
sni01110  Biosynthesis of secondary metabolites
sni01120  Microbial metabolism in diverse environments
sni01130  Biosynthesis of antibiotics
sni01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    INV104_02420 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    INV104_02420 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    INV104_02420 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    INV104_02420 (adhP)
   00626 Naphthalene degradation
    INV104_02420 (adhP)
Enzymes [BR:sni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     INV104_02420 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: CBW35926
Position
complement(261329..262348)
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GIGIVKEIAPDVKNLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAGLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctattgaagaaaaagtactc
cgtccacttgaaactggggaagcacttgtagaagttgaatactgtggcgtttgccacacc
gacctccacgttgctcatggtgactttggtcaagtcccaggacgtgttcttgggcacgaa
ggtatcggtatcgttaaagagattgctccagatgtgaaaaaccttaaagtcggtgaccgc
gtcagcgttgcttggttctttgaaggatgtggcacttgcgaatactgtacaactggtcgc
gaaaccctttgccgtacagtgaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgctgactatgctgtcaaagttcctgacggacttgatccagcccaa
gcttcttctatcacatgtgctggagtaacaacctataaagctatcaaagaagcaaaagtt
gaaccaggccaatgggttgttctttacggtgctggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgttatcgcagtcgatatcaacaatgacaaactt
gcccttgcaaaagaagtaggcgctgacattgtgattaacggcctcgaagttgaagatgta
gctggactcattaaagaaaaaactgatggaggagctcattcagctgtcgtaactgctgtg
tctaaagttgccttcaaccaggctgttgactccattcgtgctggtggtcgcgtcgtcgct
gttggtcttccttctgaaatgatggaactcagcatcgttaaaacagtcctcgatggaatc
caagtcatcggttctcttgtcggaactcgtaaagacttagaagaagccttccaatttggt
gcagaaggtctggtagtcccagttgttcaaaaacgtccagtagaagatgctgttgccatt
ttcgacgaaatggaaaaaggccaaatccaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system