KEGG   Streptococcus pneumoniae INV104: INV104_02470Help
Entry
INV104_02470      CDS       T02072                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sni00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267209..268183
Genome map
AA seq 324 aa AA seqDB search
MMKILEGVTDMSSKANHAKTVICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGANLVN
DITGLMGDEKMAHVVAKAGAKVVIMFNPVMARPQHPSSLIFPHFGFGQTFTEKELADFET
LPIEELMEAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYPI
FLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHR
MAVEIASAIRLADEAENLDLKQYK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatccttgagggagtgaccgatatgtcaagtaaagccaatcatgcaaagaca
gttatttgcggaattatcaatgtaaccccagactccttttcggacggtggtcaatttttt
gctcttgagcaggcactccagcaggctcgtaaattgatagcagaaggagccagtatgctc
gatatcggcggagaatcgactcggccgggcagtagctatgttgagatagaagaggaaatc
cagcgtgttgttccagtgatcaaagcgattcgcaaggaaagtgatgtccttatttctatc
gatacttggaaaagtcaggtggcagaggctgctttggctgcgggtgccaatctagttaat
gatatcactggtctcatgggtgatgaaaaaatggcccatgtggttgctaaagctggagcg
aaagtggtcatcatgtttaatccagttatggcgcgacctcagcatcctagttcgcttatc
ttccctcattttggctttggtcaaacctttacagaaaaagagttagctgactttgaaaca
ttgccaattgaagaattgatggaggctttctttgaacgagcactagcgagagcggcagaa
gctggtattgcaccagaaaatatcctgttggatccaggaattggctttggtctgaccaag
aaagaaaatctgcttcttttacgggacctggataaactacatcagaagggctatccaatc
tttctcggagtgtcgcgcaagcgatttgtcatcaatattctagaggagaatggttttgaa
gtcaatcctgagacagagcttggtttccgaaatcgggacacggcttcggctcatgtaact
agtatcgctgcgagacagggtgtagaagtggtgcgcgtgcatgacgtagctagtcacagg
atggcagttgaaattgcctctgccattcgtctggctgatgaagcggaaaatttagattta
aaacagtataaataa

DBGET integrated database retrieval system