KEGG   Streptococcus pneumoniae INV104: INV104_03110Help
Entry
INV104_03110      CDS       T02072                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxy-D-glucose 3,5-epimerase RmlC (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sni00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sni00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
342146..342742
Genome map
AA seq 198 aa AA seqDB search
MTDNFFGKTLAARKVEAIPGMLEFDIPVHGDNRGWFKENFQKEKVLPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPSLGIEWENLEEADVSEAD
KHHPLLKDVKPLKKEDLE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagataattttttcggtaagacgcttgcggcacgcaaggttgaagctattccaggc
atgttggagtttgatatccccgttcatggagataatcgtggctggtttaaagaaaatttc
caaaaggaaaaagtgcttccacttggatttccagagtctttctttgcagaaggaaaattg
caaaacaatgtatccttctcacgtaaaaatgtccttcgaggcctccacgcagagccttgg
gataagtacatctctgtagcagatggagggaaagttctgggttcttgggttgatctacgc
gagggtgaaacctttgggaatacctatcagacagtaattgatgcaagcaagggaatcttt
gttcctcgaggcgtagctaatggcttccaagttttatcagatacagtgtcatatagctat
ctggtcaatgattactgggctcttgaactcaaacccaagtatgcctttgtgaactacgct
gatccaagccttggtattgaatgggaaaatctggaagaagcagacgtatctgaagcagac
aaacatcatcccctacttaaggacgtgaagcctttgaaaaaagaagatttggaataa

DBGET integrated database retrieval system