KEGG   Streptococcus pneumoniae INV104: INV104_05590Help
Entry
INV104_05590      CDS       T02072                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    INV104_05590 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    INV104_05590 (glkA)
   00052 Galactose metabolism
    INV104_05590 (glkA)
   00500 Starch and sucrose metabolism
    INV104_05590 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    INV104_05590 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    INV104_05590 (glkA)
   00524 Butirosin and neomycin biosynthesis
    INV104_05590 (glkA)
Enzymes [BR:sni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     INV104_05590 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635093..636052
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPISCTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENTFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgacaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggtgataaccaaccagatgttgtctttatgacactcggt
actggtgttggtggcggtatcgtcgcagaaggcaaattgcttcacggtgttgctggtgca
gcaggtgagttgggtcacatcactgttgactttgaccagccaatctcatgtacttgcggt
aagaaaggctgtcttgagacagtcgcttctgcaacaggaattgtcaacttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaac
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtctatgacgaaaatactttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system