KEGG   Streptococcus pneumoniae INV104: INV104_06110Help
Entry
INV104_06110      CDS       T02072                                 

Definition
putative glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sni00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687039..687320
Genome map
AA seq 93 aa AA seqDB search
MDTPDENGYVADDYRITYLEAHIKAMRDAIYKDGVDLLGYTTWGCIDSVSAGTGEMNKRY
GFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggatacaccggatgagaatggttatgtagcagatgactatcggattacttacttagag
gcccacatcaaggccatgcgagatgccatttacaaagacggggttgacttgcttggttat
acgacatggggctgtatcgattcggtttcagctggcacaggggaaatgaataagcgctat
ggctttatctatgtagatcgagataatgtaggaaatgggactctcaaacgtagcaagaag
aagtccttctattggtacatgtcatttatagcaatggtgtaa

DBGET integrated database retrieval system