KEGG   Streptococcus pneumoniae INV104: INV104_08310Help
Entry
INV104_08310      CDS       T02072                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sni03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
923263..924087
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVCRCLEKLIIGKKISSIEIRYPKMIKTDLEEFQRELPSQIIESMGRRGKYL
LFYLTDKVLISHLRMEGKYFYYPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVP
DLLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLW
RAQVHPARSSQTLTAEEATAIHDQTIAVLSQAVEKGGSTIRTYTNAFGEDGSMQDFHQVY
DKTGQGCVRCGTIIEKIQLGGRGTHFCPNCQRRD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaggttgaaaccgtttgtcgttgcttagaaaaattgattatagga
aagaagatttcgagtatagaaattcgctaccccaagatgattaagacggatttggaagag
tttcaaagggaattgcctagtcagattatcgagtcaatgggacgtcgtggaaaatatttg
cttttttatctgacagacaaggttttgatttcccatttgcggatggagggcaagtatttt
tactatccagaccaaggacctgaacgcaagcatgcccatgttttctttcattttgaagat
ggtggcacgcttgtttatgaggatgttcgcaagtttggaaccatggaactcttggtgcct
gaccttttagacgcctactttatttctaaaaaattaggtcctgaaccaagcgaacaagac
tttgatttacaggtctttcaatctgcccttgccaagtccaaaaagcctatcaaatcccat
ctcctagaccagaccttggtagctggacttggcaatatctatgtggatgaggttctctgg
cgagctcaggttcatccagctagatcttcccagactttgacagcagaagaagcgacagct
attcatgaccaaaccattgctgttttgagccaggctgttgaaaaaggcggttccaccatt
cggacctataccaatgcctttggggaagatggaagcatgcaggattttcatcaggtctat
gataagactggtcaaggatgtgtacgctgtggtaccatcattgagaaaattcaactaggt
ggacgtggaacccacttttgtccaaactgtcaaaggagggactga

DBGET integrated database retrieval system