KEGG   Streptococcus pneumoniae INV104: INV104_15600Help
Entry
INV104_15600      CDS       T02072                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    INV104_15600 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    INV104_15600 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    INV104_15600 (trpB)
Enzymes [BR:sni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     INV104_15600 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1709401..1710624)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGFGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccagcttttgcgccagtacgtaggacgtgaaact
cctctttattacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttgggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaactggtgctggtcagcacggt
gtggcaactgcaactgctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgtatggagcttttgggagctaaggtc
gaggccgtgacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatagatgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaattgttcgtgacttccaaagtgtcattggtcgagaggctaaacaacagtac
cgtgacttgacaggacaaaatctgccagatgccctagtagcctgtgttggtggtgggtcg
aatgccatcggtctcttccatccctttgtagaagatgagtcagtagccatgtatggagct
gaagcggctggatttggtgtggatacggagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagctttggaatctagccatgctatc
gcctttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtatgccta
tcaggtcgtggggacaaggatgtggttcaagtaaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system