KEGG   Streptococcus pneumoniae INV104: INV104_17440Help
Entry
INV104_17440      CDS       T02072                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sni00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    INV104_17440 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    INV104_17440 (adhE)
   00620 Pyruvate metabolism
    INV104_17440 (adhE)
   00650 Butanoate metabolism
    INV104_17440 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    INV104_17440 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    INV104_17440 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    INV104_17440 (adhE)
   00626 Naphthalene degradation
    INV104_17440 (adhE)
Enzymes [BR:sni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     INV104_17440 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     INV104_17440 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1912823..1915474)
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQW
ITEPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREKLSPV
IAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
NRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWKEHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgctgaaaaacacgta
gatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaattggatcaagaa
caagttgactacatcgttgccaaagcatcagtagcagctttggatgcccacggagaattg
gctttacatgcctttgaagaaacaggacgtggtgtatttgaagataaagcaactaagaac
ttgtttgcttgtgaacacgtggtaaacaacatgcgtcacactaaaacagttggcgttatc
gaagaagatgatgtaacaggattgaccctgattgctgaaccagttggtgttgtttgtggt
atcactccaacaacaaacccaacatcaacagcgatcttcaaatcattgatttcattgaag
acacgtaatccaatcgtctttgccttccatccatcagctcaagaatcatcagctcatgca
gctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaactgtgtacagtgg
atcactgaaccatctatggaagcaactagtgcccttatgaaccacgaaggtattgcaaca
atccttgcaacaggtggtaatgccatggttaaagccgcatactcatgtggtaaaccagct
cttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagcaaacattcgtcaa
gcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtctgtgcatctgaa
caagcagttatcattgataaagaaatttacgatgaatttgtagcagagttcaaatcttac
cacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttctgcttcggcgtc
aaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatcgttggtaaacca
gcaacttggattgcagaacaagcaggatttacagttccagaaggaacaaacattcttgct
gcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaattgtcaccagtt
attgcagttttgaaatctgaaagccgtgaagatggtattactaaggctcgtcaaatggtt
gaatttaacggtcttggacactcagcagctatccacacagctgacgaagaattgactaaa
gaatttggtaaagctgttaaagctattcgtgttatctgtaactcaccttctacttttggt
ggtatcggggacgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactcagttggggataacgttagtgccattaacctcttgaatatcaaaaaagtc
ggaagacggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatgatcgttactgac
catgccatggtagagcttggtttccttgatcgtatcatcgaacaactggaccttcgtcgc
aataaggttgtttaccaaatctttgcggatgtagaaccggatccagatatcacaactgta
aaccgtggtactgagattatgcgtgccttcaaaccagataccatcatcgcactcggtggt
gggtctccaatggatgctgccaaagtaatgtggctcttctacgagcaaccagaagtggac
ttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttcaagttcccattg
cttggtaagaagactaaattcatcgcgattccaactacatctggtacaggatctgaagta
acaccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgtagatcctgctttggtattgacagttccaggattt
gttgctgctgatactggtatggacgtattgactcacgcgacagaagcatacgtatcacaa
atggctagtgactacactgatggtttagcacttcaagccattaaattggtctttgaaaat
ctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatgcataacgcttca
acaatcgctggtatggcctttgccaatgccttcctaggtatttctcactcaatggcccat
aagattggtgcgcaattccacacaatccacggtcgtacaaatgctatcttgcttccatac
gttatccgttacaacggtacacgtccagctaagacagcaacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgcacgcatgcttggacttccagcttctact
ccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggtgaacgtattggg
atccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaagaacattctcgt
gaattagccttcctggcttatgaagaccaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaagaaagaccagga
cgccgtaaataa

DBGET integrated database retrieval system