KEGG   Streptococcus pneumoniae INV104: INV104_18170Help
Entry
INV104_18170      CDS       T02072                                 

Gene name
malQ
Definition
putative 4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sni00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000766..2002283)
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGATSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLGASDLEGVDFGSDASEVDYAKIYYARRPLLEKAVKRFF
EVGDVKDFEKFAQDNQSWLELFAEYMAIKEHFDNLAWTEWPDADARARKASALESYREQL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDVNG
KATCIAGCPPDEFSVTGQLWGNPIYDWEAMDKDGYKWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGEWVKGPGYKLFAAVKEELGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDATREYMARYTN
RKEYETVVHAMLRTVFSSVSFMAIATMQDLLELDEAARMNFPSTLGGNWSWRMTEDQLTP
AVEEGLLDLTTIYRRINENLVDLKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatctcttctcttccaggagcttacgga
atcggatcatttggtcaaagtgcttacgacttcgttgatttcttggtccgtacaaaacaa
cgttactggcaaatccttccattaggagcaactagttacggggattctccttaccaatct
ttctcagccttcgcaggaaacactcattttatcgatttagatatcttggtggagcaaggt
ttgttgggagcgagtgaccttgaaggagttgactttggtagcgatgcgtctgaagttgac
tatgctaaaatctactatgcacgtcgtcctcttttagaaaaagcggtgaaacgtttcttt
gaagtcggagatgttaaagattttgagaaatttgctcaagacaaccaatcatggcttgag
ctctttgctgagtatatggctatcaaagagcattttgacaatcttgcttggactgaatgg
ccagatgcagatgctcgtgctcgtaaagcttcagcacttgaaagctatcgtgagcaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttgaaa
ttgaaagcttacgctaacgacaaccacattgaaatcgttggggacatgccaatctacgta
gcggaagattcaagtgatatgtgggcaaatccacatctcttcaaaacagatgtcaatggt
aaggctacttgtatcgcaggatgcccaccagatgagttttctgtaactggtcagctttgg
ggtaacccaatctatgactgggaagcaatggacaaagacggctacaaatggtggattgaa
cgcttgcgtgaaagcttcaaaatctacgatatcgttcgtatcgaccacttccgtggcttc
gaatcttattgggaaatccctgctggttccgatacagcagcacctggtgagtgggtgaaa
ggtccaggctacaagctttttgcagccgttaaggaagaacttggtgagctaaacatcatc
gcagaagaccttggcttcatgacagatgaagtgatcgaattacgtgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaacccagaagacgaaagcattgatagccca
cacttggcacctgctaactcagttatgtacacaggaacacacgataacaatacggttctt
ggttggtaccgtaatgagattgatgatgcgactcgtgagtacatggctcgttacacgaac
cgtaaagaatacgaaacagtggtacacgctatgcttcgtacagtattttcatcagttagc
tttatggcaattgcaactatgcaagatttactagaattggatgaggcagctcgtatgaac
ttcccatctacccttggtggaaactggtcttggcgtatgactgaagatcaattgacacca
gctgtcgaggaaggtttgcttgacttgacaacaatttatcgccgaattaatgaaaatttg
gtagatttaaagaaataa

DBGET integrated database retrieval system