KEGG   Streptococcus pneumoniae 70585: SP70585_0224Help
Entry
SP70585_0224      CDS       T00872                                 

Definition
(GenBank) acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
snm00300  Lysine biosynthesis
snm01100  Metabolic pathways
snm01120  Microbial metabolism in diverse environments
snm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SP70585_0224
Enzymes [BR:snm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SP70585_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 BMC
Motif
Other DBs
NCBI-ProteinID: ACO17365
UniProt: C1CAH1
Structure
PDB: 

Jmol
Position
197119..198492
Genome map
AA seq 457 aa AA seqDB search
MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEV
EIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRG
VDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTDLDKYLEKHADKLRGADL
LVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLR
AADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIYGLELPLLQEERMAFLKRFF
FDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV
ELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHTVFDALEVPMVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcctagcgaacaagaacagattgaaaaatttgaaaaggatcatgtagcccag
cattattttgaggttttgcgtaccttgatttctaagaaatcagtctttgcccagcaggtt
ggactcaaggaagtcgcaaattatctgggtgagattttcaagcgtgttggagctgaagtg
gagattgatgagagctatacagctccctttgtcatggcacatttcaagagttcgcgtcca
gatgccaagaccttgattttctataaccactatgacactgtgccagcggatggggatcag
gtctggacagaggatccttttacgctttcggtccgcaatggcttcatgtatgggcgtggg
gttgatgacgacaagggtcatatcacagctcgcttgagtgctttgagaaaatatatgcag
caccatgatgatttacctgtcaatatcagctttatcatggagggagcggaggaatcggct
tcaacagacctagataagtatttggaaaagcatgcagacaaactccgtggggcggatttg
ttggtctgggaacaagggaccaaaaatgccttggaacagctggaaatttctggtggcaat
aaggggattgtgacctttgatgccaaggtaaaaagcgctgatgtggatatccactcgagt
tatggtggtgttgtggaatcagctccttggtatctcctccaagccttacagtctcttcgt
gctgcggatggccgtatcttggttgaaggcttgtacgaagaagtacaagagcccaatgaa
cgagaaatggccttgctagaaacttatggtcaacgaaacccagaggaagttagtcggatt
tatggattggagttgcctctcttacaggaggagcggatggcctttctaaaacgtttcttt
ttcgatccagcgcttaatatcgaaggaatccagtctggttatcaaggtcagggtgttaag
actattttacctgcagaagccagtgccaagctagaggttcgtctggttccgggcctagaa
ccgcatgatgttctggaaaaaattcggaaacaactagacaaaaatggctttgataaggta
gaattatactataccttgggagagatgagctatcgaagcgatatgagcgcaccagccatt
ctcaatgtgatcgagttggccaagaaattctatccacagggcgtttcagtcttgccgacg
acagcggggacaggacctatgcatacggtctttgatgccctagaggtaccaatggttgca
ttcggtctaggaaatgccaatagccgagaccacggtggagatgaaaatgtgcgaatcgct
gattattacacccatatcgaattagtagaggagctgattagaagctatgagtag

DBGET integrated database retrieval system