KEGG   Streptococcus pneumoniae 70585: SP70585_0348Help
Entry
SP70585_0348      CDS       T00872                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:snm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
307917..308897
Genome map
AA seq 326 aa AA seqDB search
MVKSLEGVTDMSSKANHAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTRKSQVAEAALAAGANL
VNDITGLMGDEKMAHVVAKAGAKVVIMFNPVMARPQHPSSLVFPHFGFGQAFTEEELSDF
ETLPIEDLMEAFFDRALARANQAGIAQENILLDPGIGFGLTKKENLLLLRDLDKLHQKGY
PIFLGVSRKRFVINILEESGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVAS
HRMAVEIASAIRLADEAENLDLKQYK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaagccttgagggagtgaccgatatgtcaagtaaagccaatcatgcaaagaca
gctatttgcggaattatcaatgtaaccccagattccttttcggatggtggtcaatttttt
gctcttgagcaagcgctccagcaggctcgtaaattgatagcagaaggggctagtatgcta
gatatcggcggagaatcgactcggcctcggccgggaagtagctatgttgagatagaagag
gaaatccagcgtgttgttccagtgattaaagcgattcgcaaggaaagtgatgtcctcatc
tctattgatactcggaagagtcaggtggcagaggctgctttggctgctggtgccaatcta
gtcaatgatatcactggtcttatgggtgatgagaaaatggcccatgtggttgctaaggct
ggtgcgaaagtagtcattatgtttaatccagtcatggcgcgacctcagcaccctagctcg
ctcgtatttcctcattttggttttggacaagcttttacagaggaagagttatctgacttt
gaaacattgccaatcgaagacttgatggaggctttctttgacagagccttagcgagagcg
aatcaagctggaatcgcacaagaaaatatcctgttggatccaggaattggctttggtctg
accaagaaagaaaatctgcttcttttacgtgacctggataaactacatcagaaaggttat
ccaatctttcttggagtgtcgcgcaagcgatttgtcatcaatatccttgaagaaagtggt
tttgaagtcaatcctgagacagaacttggtttccgcaatcgagatacggcttcggctcat
gtaaccagtatcgctgcgagacagggtgtggaagtggtgcgcgtgcatgatgtagctagt
cacaggatggcagttgaaattgcttccgctattcgtctggctgatgaagcggaaaatcta
gatttaaaacaatacaaataa

DBGET integrated database retrieval system