KEGG   Streptococcus pneumoniae 70585: SP70585_0367Help
Entry
SP70585_0367      CDS       T00872                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP70585_0367 (celA)
Enzymes [BR:snm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SP70585_0367 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321802..323238
Genome map
AA seq 478 aa AA seqDB search
MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAREITLGVLEGKYYPNH
EAIDFYHRYKEDIALFAEMGFKCFRTSLAWTRIFPKGDELEPNEEGLQFYDNLFDECLKN
GIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKRYKDKVKYWMTFNEINNQ
ANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAVKIGHEINPDFQIGCMIAM
CPIYPATCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFKYWERKGISVDFTDQDKEDL
LGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNNYVKASEWEWQIDPEGLRYAL
NWFTDHYHLPLFIVENGFGAIDQVAADGMVHDDYRIEYLGAHIREMKKAVVEDGVDLMGY
TPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRSPKKSFGWYKEVISSNGELVE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactacttttaaagatggatttttatggggtggtgctgttgctgctcatcaacttgaa
ggcggatggcaagaaggtggcaagggaattagtgttgctgatgttatgactgctggtcgt
catggagtagctcgtgaaattactttgggagttttagagggtaaatattatccaaatcat
gaggcgatagatttttatcatcgttataaagaagacatagcactttttgctgaaatggga
ttcaagtgcttccgtacctctcttgcatggacacgtatctttccaaaaggtgatgagtta
gagccgaatgaagaaggattacagttttatgataatctttttgatgaatgcttaaagaat
ggtattgaacctgtcatcactctatctcattttgaaatgccttatcacttagtgaccgaa
tatggtggttggaaaaataggaaattgattgatttctttgctcgttttgcagaagtcgta
tttaaacgttacaaagataaggttaaatattggatgacttttaatgaaatcaataatcaa
gcgaattatcaggaagattttgcaccatttactaactcaggtattgtatatgaggaaggt
gataatagagaagcaattatgtatcaagcagcacattacgaattagttgcttctgcacga
gctgtaaaaattggtcatgagattaatccagattttcaaataggttgtatgattgcgatg
tgtccaatttatccagctacttgcaatcctaaggatatcttaatggcaatgaaagctatg
cagaagcgttattattttgctgatgtgcatgttttaggtaaatatcctgagcatattttc
aagtattgggaacgaaaaggtatttcagttgattttactgaccaggataaagaagattta
cttggtgggactgtagattacattggtttcagttactatatgtcctttgctatagactct
catcgtgaaaataatccttattttgattatcttgaaacagaagatttagtgaaaaataat
tatgttaaggcttctgaatgggagtggcaaattgatccagaaggtttacgttatgcgtta
aattggtttacagaccactatcacttaccactctttattgttgaaaatggttttggagct
atagatcaagttgcagcagatggtatggtacatgatgattatagaattgaatatctaggt
gcccatattcgtgaaatgaaaaaggctgtagttgaagatggtgttgatttaatgggttat
actccatggggatgtattgatttggtttcagctggtaccggtgaaatgcggaaacgttat
ggctttatttatgtagataaagatgacaatgggaagggaagttataatcgttccccgaaa
aaatcttttggctggtataaggaagttatttcatctaacggtgaattagtagaatag

DBGET integrated database retrieval system