KEGG   Streptococcus pneumoniae 70585: SP70585_0642Help
Entry
SP70585_0642      CDS       T00872                                 

Definition
beta-glucosidase (Gentiobiase) (Cellobiase) (Beta-D-glucoside glucohydrolase) (Amygdalase) (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571174..572589
Genome map
AA seq 471 aa AA seqDB search
MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEATENPTEDNLKLLGIDF
YHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDKEEPNEAGLKYYDELFDELHAHGIEPL
VTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLKRYKDKVKYWLTFNEVNSVLELPF
TSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEFKVGCMVLAMPAYPMTPNP
KDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIEFAAEDAELLKNYTVDFLSF
SYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQIDPIGLRIILNRYYDRYQIPL
FIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQVAEALQDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWYKGVIESNGESLFK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttttccagatgattttctttggggtggagctgttgcagctaatcaagtagag
ggagcatataatgaagatggtaagggattatcagttcaggatgtgttacccaaaggtgga
ttaggagaagcaacagaaaatcctacagaagataacttaaagttgttaggtattgatttt
tatcataaatataaggaagatatatccttgttttctgaaatgggctttaatgtttttcgt
acttctattgcatggagtagaatttttccaaaaggagataaggaagaacctaacgaagct
ggtttgaaatattatgatgaattatttgatgaactacatgctcacgggatagaaccactt
gtaactctttcacactatgagactccattatatttagcaagaaaatatcatggatggatt
gataggagaatgattcatttttatgaaaaatttgctcgaacagttttaaaaaggtataaa
gataaagttaaatattggcttacatttaacgaagtaaactctgttttggaattaccgttt
actagtggaggaatagatatacctaaggagaatctttcgaaacaagaattatatcaagct
atacatcatgaattagtcgcctcgagtttggttacaaaaattgctcgtgagattaattca
gagtttaaggtggggtgtatggtattagctatgccagcttatccaatgactccaaatcca
aaagatgtatgggcgactcatgagtatgagaatctaaattatctattttcagatgtgcat
gttagaggttattatccgaattatgcaaaaagatattttaaggaacatgacattaacata
gagtttgcagctgaagatgcagagttattaaaaaattataccgtagattttttatccttt
agctattacatgagtgtgactcaatctgctcttccaacacagtataattcaggagaaggg
aatattattggtggtttagtaaatccttatttagagtcttcagagtggggatggcaaatt
gatccaattggactacgtataattttaaatagatattatgaccgttatcaaattccatta
tttatagtggaaaacggattaggtgctaaagatcaactaataaaagatgaatttaataac
ttaacagtccaagatgattatagaattcagtatatgaaagaacatttattgcaagtagct
gaagctctacaagatggtgtggaaattatgggctatacgtcttggggatgtattgactgc
gtttctatgtccactgcacagctttctaagaggtacggtctcatttatgttgatcgaaat
gatgatggaaatggcacattcaatcgatataagaaaatgtcctttacttggtataaagga
gtgattgaatcaaatggagaatccttattcaaatag

DBGET integrated database retrieval system