KEGG   Streptococcus pneumoniae 70585: SP70585_0727Help
Entry
SP70585_0727      CDS       T00872                                 

Definition
(GenBank) glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
snm00010  Glycolysis / Gluconeogenesis
snm00052  Galactose metabolism
snm00500  Starch and sucrose metabolism
snm00520  Amino sugar and nucleotide sugar metabolism
snm00521  Streptomycin biosynthesis
snm01100  Metabolic pathways
snm01110  Biosynthesis of secondary metabolites
snm01120  Microbial metabolism in diverse environments
snm01130  Biosynthesis of antibiotics
snm01200  Carbon metabolism
Module
snm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP70585_0727
   00052 Galactose metabolism
    SP70585_0727
   00500 Starch and sucrose metabolism
    SP70585_0727
   00520 Amino sugar and nucleotide sugar metabolism
    SP70585_0727
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SP70585_0727
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SP70585_0727
Enzymes [BR:snm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SP70585_0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACO16174
UniProt: C1C630
Position
667834..668793
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDREKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPIACTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaaatggtcaatcaagacaaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgaaaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggagataaccaaccagacgttgtctttatgacactcggt
actggtgttggtggcggtatcgtcgcagaaggcaaattgcttcacggtgttgctggtgca
gcaggtgagcttggtcacatcactgttgactttgaccagccaatcgcatgtacttgcggt
aagaaaggctgccttgagacagttgcttcagcaacagggattgtcaacttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaac
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system