KEGG   Streptococcus pneumoniae 70585: SP70585_1155Help
Entry
SP70585_1155      CDS       T00872                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SP70585_1155 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SP70585_1155 (murA1)
Enzymes [BR:snm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SP70585_1155 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1056972..1058231
Genome map
AA seq 419 aa AA seqDB search
MRKIVINGGLPLQGEITISGAKNSVVALIPAIILADDVVTLDCVPDISDVASLVEIMELM
GATVKRYDDVLEIDPRGVQNIPMPYGKINSLRASYYFYGSLLGRFGEATVGLPGGCDLGP
RPIDLHLKAFEAMGATASYEGDNMKLSAKDTGLHGASIYMDTVSVGATINTMIAAVKANG
RTIIENAAREPEIIDVATLLNNMGAHIRGAGTNIIIIDGVERLHGTRHQVIPDRIEAGTY
ISLAAAVGKGIRINNVLYEHLEGFIAKLEEMGVRMTVSEDSIFVEEQSNLKAINIKTAPY
PGFATDLQQPLTPLLLRANGRGTIVDTIYEKRVNHVFELAKMDADISTTNGHILYTGGRD
LRGASVKATDLRAGAALVIAGLMAEGKTEITNIEFILRGYSDIIEKLRNLGADIRLVED
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgttatcaatggtggattaccactgcaaggtgaaattactattagtggt
gctaaaaatagtgttgtggccttaattccagctattatattggctgatgatgtggtgact
ttggattgtgttccagatatttcggatgtagccagtcttgtcgaaatcatggaattgatg
ggagctactgttaagcgttatgacgatgtcttggagattgatccaagaggtgttcaaaat
attccaatgccttatggtaaaattaacagtcttcgtgcatcttattatttttatgggagc
ctcttaggccgttttggtgaagcgacagttggtctaccgggaggatgtgatcttggtcct
cgtccgattgacttacaccttaaggcgtttgaagctatgggtgccactgctagctacgag
ggagataacatgaagttatctgctaaagatacaggacttcatggtgcaagtatttacatg
gatacggttagtgtgggagcaacgattaatacgatgattgctgcggttaaagcaaatggt
cgtactattattgaaaatgcagcccgtgaacctgagattattgatgtagctactctcttg
aataatatgggtgcccatatccgtggggcaggaactaatatcatcattattgatggtgtt
gaaagattacatgggacacgtcatcaggtgattccagaccgcattgaagctggaacatat
atatctttagctgctgcagttggtaaaggaattcgtataaataatgttctttacgaacac
ctggaagggtttattgctaagttggaagaaatgggagtgagaatgactgtatctgaagac
agcatttttgtcgaggaacagtctaatttgaaagcaatcaatattaagacagctccttac
ccaggctttgcaactgatttgcaacaaccgcttacccctcttttactaagagcgaatggt
cgtggtacaattgtcgatacgatttacgaaaaacgtgtaaatcatgtttttgaactagca
aagatggatgcggatatttcgacaacaaatggtcatattttgtacacgggtggacgtgat
ttacgtggggccagtgttaaagcgaccgacttaagagctggggctgcactagtcattgct
gggcttatggctgaaggtaaaactgaaattaccaatatcgagtttatcttacgtggttat
tctgatattatcgaaaaattacgtaatttaggagcggatattagacttgttgaggattaa

DBGET integrated database retrieval system