KEGG   Streptococcus pneumoniae 70585: SP70585_1296Help
Entry
SP70585_1296      CDS       T00872                                 

Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SP70585_1296
Enzymes [BR:snm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SP70585_1296
Peptidases [BR:snm01002]
 Cysteine Peptidases
  Family C44
   SP70585_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1199135..1200859)
Genome map
AA seq 574 aa AA seqDB search
MVNKYFFEKYSDKKIVFLTKNLYRTVSGENKKIYCLEDYVEGVCSIIEQNDISSFEEIIL
ALQDYVTNGLIIVEMTERTYIISPYLDSRLSWFENNKNIIFSDSSVEIAKYLNLKLSTKR
LASQFIFGLPYYPFQTISLWEELVNIRPLNYLEISEKGCLEKRVPSYEVDTKDFNKLIIK
IKEEFLNSINHDLNMRNEVSSDVSGGVDSATIAFTLNKLIPDFSILHAESSTTANSDTKW
ATFIAKSLGRELKKFDSIEITEKRFAIDEKYINDIMPSSPLLWADSEGYLKSVIGYQKGR
KQPTHFLGIGGDELFTPMPSNSWNIVRQENLGGLLYALKYSLIMRRPFFSCLLDLLDNRG
YSETVIKNLEIVFNESSAPIKRELGWVDGLQVPDWLSEKSKQESQIFLNSLLFSNSEPII
SDRTAFQMIQSLIFQKSVLRQIQLTTNSIYWATPFLHKKLIEICLQIPAKYKVSSKLTKP
ILQKALKGIVPIEVFNRGFKGDYSDALYSGYREAVRKNFHNLEQFELVKMGIIDVEKLKL
EMSLPAGNPSKIDYFEKLCSVERWIRQIKLYMKN
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataagtatttttttgaaaaatattctgataaaaaaatagtattccttactaaa
aatttatatagaaccgtttctggagagaataaaaaaatctattgtttagaagattatgtc
gaaggagtatgctcaattatagaacaaaatgatattagtagttttgaagaaataatatta
gcacttcaagattatgttacaaatggtttaattattgttgaaatgactgaaagaacatat
attatttcaccttatttagattcaagactgtcttggtttgagaataataagaatataatt
tttagtgattcatctgtagaaattgcaaaatatttgaatttaaaactctctacgaagcgt
ttagcaagtcaatttatttttggacttccatattatccatttcaaacaattagcctctgg
gaagagctagtgaatataagacctttaaactatttagaaatatctgaaaaaggttgttta
gaaaaaagagttccgagttatgaagtagacacaaaagattttaataaactaataataaaa
ataaaagaggagtttttaaatagcattaatcatgatttgaatatgagaaatgaagtgtcg
agtgatgtatcaggaggtgttgattctgcaactattgcttttacattgaataaactgata
cctgacttctctattttgcatgctgaatcaagtaccactgctaatagtgatactaaatgg
gcgacatttattgctaaaagtcttggtagggagttgaaaaagtttgactcaatagaaata
acagaaaaaagatttgcgatagatgaaaaatatatcaatgatattatgccaagttctccg
ttattgtgggcggattcagaaggatatttgaaatcagtgattggttaccagaaaggtaga
aaacaaccgactcactttctaggtattggtggtgatgaattatttacaccgatgccgtct
aattcctggaatattgttcgtcaggaaaatttaggtggactactttatgctctgaaatat
agtttaataatgagaagaccattttttagttgcctattggatttgttagataatagagga
tattcggaaactgtgatcaaaaatttagaaattgttttcaacgaatcttctgcacctatc
aagagagaactgggatgggtggatggtttacaagtaccagattggctcagtgaaaaatcc
aaacaagaatcgcaaatttttttaaactcgttattattttccaattctgagccaataata
tctgataggacagccttccaaatgattcaatccttaatatttcaaaaatcagtattgcga
caaattcaattaaccactaattccatttattgggcaactccatttttacataaaaaatta
atagaaatttgtcttcaaattccagcaaaatataaagttagttcaaaactaacaaaaccg
atattgcaaaaagcattgaagggaatcgtaccaattgaggtttttaacaggggtttcaaa
ggggattattcagatgccttatatagtggatatagagaagcagttcgtaaaaacttccac
aatttagaacagtttgaattggttaaaatgggtattattgatgttgagaagttaaaatta
gagatgtcattacccgcgggaaatccgagtaaaattgattattttgaaaagttatgttcg
gtagaacgttggatacggcagatcaaattatatatgaagaactag

DBGET integrated database retrieval system