KEGG   Streptococcus pneumoniae 70585: SP70585_1875Help
Entry
SP70585_1875      CDS       T00872                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
snm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snm01100  Metabolic pathways
snm01110  Biosynthesis of secondary metabolites
snm01130  Biosynthesis of antibiotics
snm01230  Biosynthesis of amino acids
Module
snm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SP70585_1875 (trpC)
Enzymes [BR:snm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SP70585_1875 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NeuB DUF5390
Motif
Other DBs
NCBI-ProteinID: ACO17800
UniProt: C1C968
Position
complement(1741316..1742083)
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAHEVEQMKLEQIQPLRQTYRLAEFLKNHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGTVMISVLTDEVFFKGHLNYLREISSQVEIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALSEERLKKLYDYATELGLEVLVETHNLAELEVAHRLGAEIIG
VNNRNLTTFEVDLQTSVDLAPYFEEGRYYISESAIFTGQDAERLAPYFNGILVGTALMQA
ENVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagagcagaaggcgcatgaggtggagcagatg
aagctggagcaaatccagcctctgcgccagacctatcgcttggcagaatttttgaagaat
catcaggaccgcttgcaggtaatcgctgaggtcaagaaagctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagaaaacggaacagtg
atgatttcggtgttgacagatgaggttttctttaaagggcatttgaattatctacgggaa
atttccagtcaggtagagattccgacgctcaacaaagactttatcatagatgaaaagcaa
atcatccgcgctcgcaatgcaggtgcgacagttatcttgcttattgtggcagccttgtcc
gaagaacgcctcaagaaactgtatgactacgcgacagagcttggtctggaagtcttagtg
gagactcacaatctagctgaactagaggtagcccacagacttggtgctgagattatcggg
gtcaacaaccgcaacttgactacctttgaggtcgacttgcagaccagtgtagatttagcc
ccttactttgaggaaggtcgctattacatttctgaatctgctattttcacagggcaggat
gcggaacgactagccccatactttaacggaattttggtagggacagctcttatgcaggca
gaaaatgtggcccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system