KEGG   Streptococcus pneumoniae 70585: SP70585_2198Help
Entry
SP70585_2198      CDS       T00872                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
snm00040  Pentose and glucuronate interconversions
snm00052  Galactose metabolism
snm00500  Starch and sucrose metabolism
snm00520  Amino sugar and nucleotide sugar metabolism
snm01100  Metabolic pathways
snm01130  Biosynthesis of antibiotics
Module
snm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SP70585_2198 (galU)
   00052 Galactose metabolism
    SP70585_2198 (galU)
   00500 Starch and sucrose metabolism
    SP70585_2198 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SP70585_2198 (galU)
Enzymes [BR:snm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SP70585_2198 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACO15891
UniProt: C1CAR9
Position
2006253..2007152
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDKTTDMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAID
TLNKTQRVFAREFNGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagtcatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaagctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctattgaggatcactttgattcaaacttcgaattggaatataacctcaaa
gaaaaagggaaaacagatcttttgaagctagttgataaaacaactgacatgcgtctgcat
tttatccgccaaactcatccacgcggtctcggagatgctgttttgcaagccaaggctttc
gtcggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgaa
aaggctgttccacttaccaaacaactcatggatgactacgagcgtacccacgcgtctact
atcgctgtcatgccagtccctcatgacgaagtatctgcttacggggttattgctccgcaa
ggcgaaggaaaagatggtctttacagtgttgaaacctttgttgaaaaaccagctccagag
gacgctcctagcgaccttgctattatcggacgctacctcctcacgcctgaaattttccaa
atcctcgaaaaccaagctccaggtgcaggaaatgaaattcagctgacagatgcaatcgac
accctcaataaaacacaacgtgtatttgctcgtgagttcaatggggctcgttacgatgtc
ggagacaagtttggcttcatgaaaacatccatcgactacgccctcaaacacccacaagtc
aaagatgatttgaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system