KEGG   Streptococcus pneumoniae 70585: SP70585_2234Help
Entry
SP70585_2234      CDS       T00872                                 

Definition
beta-N-acetylglucosaminidase/beta-glucosidase (3-beta-N-acetyl-D-glucosaminidase/beta-D-glucosidase)(Nag3) (EC:3.2.1.21 3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SP70585_2234
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SP70585_2234
Enzymes [BR:snm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SP70585_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2043062..2044852)
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLRKKPYNLDEEAISWVENTIAQMTLDEKIGHLFVNMGIQRTEKYLTGVLEDYKI
AAVRYNPGPAADIWEQNYILQTKSKIPLLIAANTESGGNGAVTDGTKIGDEIKIAATADS
RHAYEMGKVAGIEAAAVGCNASFAPIMDLSRNWRNPIIANRTWGADVDQVIELSKEYMRG
IMEHGIVPFAKHFPGDGIDERDHHLSFASNPMTKSEWMETFGRIYGEMADAGLPGIMAGH
IHLPNVEKEMHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMIGMTASMPRR
ELLPTAIEAGCDLFLFFNDPEEDLQWMKEGLKNGLLTEERLHDALRRTLGLKAKLGLHLF
EGRRQEIMLPKEEALALIGKDEAKNLAKEVADKAITLVKSKQEGIFPVNPDRYKRILLVE
VDGYKGGFGAMINAGKKRAADTLKELLEARGHEVSIWENTEARIAKLPEEERPAAIANVY
ASKRPIAEITDNYDLIINLVDVNSGGTTQRIIWPAAKGTPDQPFYVHEIPTIVVSVQHPF
ALADMPQVATYINAYDGLPVTLETLVTKLAGESSFTGVSPVDAYCGLVDTHIWRGN
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttggtagacttacggaagaaaccttataaccttgatgaagaagctatttca
tgggttgaaaatacgattgctcagatgacattggatgaaaaaataggacatctctttgtc
aacatgggtatccagcggacggagaaatatctgacaggagtattggaagattacaagatt
gctgctgttcggtataatccagggccagcggcagatatttgggaacaaaactatattttg
caaactaagtccaaaattcctctcttaatagcagcaaacacagaatctggtggaaatggt
gctgttacagatggaacaaaaattggcgatgaaatcaaaattgcagcaacagctgattct
cgccatgcttatgagatggggaaagttgcagggattgaagcagcagcagtaggctgtaac
gcttcctttgcaccgattatggatcttagccgcaactggcgaaatccaattatcgccaat
cgtacttggggagcagatgttgaccaagtgattgaactgtctaaagaatacatgcgtggg
attatggaacatggcattgtgccttttgcgaagcattttcctggcgatggtattgatgaa
cgcgatcaccacctctcttttgcttctaatccaatgacaaaatctgaatggatggaaacc
tttggacggatttacggtgaaatggctgatgcaggtcttccaggtatcatggcggggcac
attcatttgccaaatgttgagaaagaaatgcatccagaacgtgaattggatgatatgttg
ccagcttcgttgaataaaaccctcttggatgaattgttgcgtggggagttaggctacaac
ggcgcaattgtgacggatgctagtcacatgattggtatgacagcatctatgccacgtcgt
gagctcttaccgacagctattgaagcgggctgcgatctcttcctctttttcaatgatcct
gaagaagatttgcaatggatgaaagaggggttgaaaaatggacttctcactgaggagcgg
ctccatgatgctcttcgtcggaccttgggcttgaaagctaaactcggcctccaccttttt
gaaggtcgtcgtcaggaaattatgttgccaaaagaagaagcgctggctttaattggaaaa
gatgaggctaaaaatcttgcaaaagaagtagctgacaaggctattaccttggtaaaatcc
aagcaagaaggcattttcccagtcaatccagatcgctataaacggattttattggttgaa
gtcgacggctacaaaggtggctttggtgccatgattaatgcaggaaagaagagggcggct
gatacgctaaaagaattgttagaagcacgaggtcacgaagtgtctatctgggaaaataca
gaagcaaggattgccaaattaccagaagaagaaagaccagctgcgattgctaatgtctat
gcatctaagcgtcctattgcagaaatcacagataactatgatttgattatcaatttggtt
gatgtcaattcaggtggaacaactcaacgaattatttggcctgctgccaagggaacacca
gatcagccgttctatgttcatgaaataccaaccatcgttgtttctgttcagcatcccttt
gctctggcagatatgccacaagtagcaacctatatcaatgcctatgatggtttaccagta
actttggaaaccttagttaccaaactagcaggagaatcatcgtttacaggagtgtcccct
gttgatgcttactgtggcttggtagatacacatatttggcgtgggaattaa

DBGET integrated database retrieval system