KEGG   Streptococcus pneumoniae 70585: SP70585_2285Help
Entry
SP70585_2285      CDS       T00872                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SP70585_2285
Enzymes [BR:snm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SP70585_2285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2096611..2097339)
Genome map
AA seq 242 aa AA seqDB search
MSQDEKLIREQICDVCHKMWQLGWVAANDGNVSVRLDEDTILATPTGISKSFITPEKLVK
LNLKGEILEAEGDYCPSSEIKMHIRCYEEREDVRSVVHAHPPIATGFALAHIPLDTYSLI
ESAIVVGAIPITPFGVPSTMEVPEAITPYLPDHDVMLLENHGALTVGSDVITAYYRMETL
ELVAKTTFHGRMLLSTKGIEEQEIARPTLERLFSMRENYKVTGRHPGYRKYNGDGSMKET
EK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatgaaaaattaattcgtgaacagatttgtgatgtttgtcataagatgtgg
caacttggttgggttgctgctaacgatgggaatgtatctgttcgattagatgaggatacc
attcttgcaacacctactggtatcagcaaaagttttattacaccagaaaagctggtgaag
ttaaatcttaaaggagagattttagaagcagaaggtgattactgtccttctagtgaaatt
aaaatgcacattcggtgctacgaagaacgtgaggatgttcgttcagttgttcacgcgcat
ccaccgattgcaacaggatttgctcttgcacacattcctttagatacttattcactaatt
gagagcgcgattgtggtaggggcaattcctataacgccatttggagttccgtctacaatg
gaagtgccagaagcaattacaccttatctgcccgatcatgatgtcatgctattagaaaat
catggagctctgactgtcggaagcgatgtaattacagcatactaccgtatggaaacttta
gaattagtcgcaaagacaaccttccacggaagaatgttactttctacaaagggcattgag
gagcaagaaattgctcgtccgactttagaacgtctattctcaatgcgagaaaattataag
gttacaggtcgtcacccaggctaccgtaaatataatggcgatggtagtatgaaagaaaca
gaaaaataa

DBGET integrated database retrieval system