KEGG   Streptococcus pneumoniae 70585: SP70585_2287Help
Entry
SP70585_2287      CDS       T00872                                 

Definition
alpha-galactosidase AgaN
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SP70585_2287
  Lipid metabolism
   00561 Glycerolipid metabolism
    SP70585_2287
   00600 Sphingolipid metabolism
    SP70585_2287
Enzymes [BR:snm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SP70585_2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2100382..2102598)
Genome map
AA seq 738 aa AA seqDB search
MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVS
FSEEFEDIQQSMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQGFELEKGKNRLNSL
PSTFDDIGQCAETLTIILTDSILYLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAM
SLQLDLPDSQYDFIQFSGAWLRERQLYRTSLRPGIQAIDSLRYSSSPQQNPFFMLSRRET
TEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVEFRFLLNPAESFVTPEAIVIY
SDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLSTEKILDLAKAAKDLG
IELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDM
NRHITDIYSIELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMY
YAPQAWTSDDTDPIERLKIQHGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFS
SFGYELDVTRLSVEEKEQVREQIQFYKKYRSLLQYGDFYRINSPFSCDSASWQVVSKDKC
QSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSGFDEFFYGDELMNAGIKVSLSNLALC
VPEYLTKLFVIEEVVCKY
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatattaataaggacgagaccgtttttcatttggcaatgaaagatagtagt
tatatttttagaattttagaaaatggggaacttcaacatctacattttgggaaaaggatt
catgtcaaggaaaattataaccaattgatggcctatgaaaaaagaggatttgaagtatct
ttttctgaagaatttgaggatattcaacagtctatgatacaaaatgaatattcttcatat
gggaaaggagattttcggcatccagcctttcaagttcaaggaatgaatggtagtaggata
acgacactaaaatatcaaggttttgaacttgaaaaagggaaaaatcgtcttaactctcta
ccttcaacatttgatgatattggtcagtgtgcggaaacattaacgattattttaacagat
tccatattatatttaactgttagactaaattacacaatttttccggaatacaatgtctta
gttagaaatacggaatttttaaataatagcaataataagttgactcttttgaaagcaatg
agcttacagctagatctacctgatagtcaatatgactttattcaattttctggagcatgg
ctgagggaacgtcagttatatagaacttcgcttagaccaggtattcaagcaatagatagc
ttgagatactcatcaagtcctcagcaaaatcctttctttatgctatcaaggagggaaact
acagagcatagtggtgaggtttatggttttaactttatctattctggaaattttcaaaat
atgattgaagttgaccattttgacaccgctagagtaacggtaggaataaatccagtagaa
tttcgttttttattaaatcctgccgaaagttttgtgacaccagaagcaattgtgatctat
tctgatcaagggatgaatcagatgagccaacaactatcagatttttatcgacatcattta
gttaatcctaatttttctcaagctagtcgtcctataatactcaatagttgggaaacattt
tattttgacttgagtacagaaaaaattttagatttagcaaaggctgctaaagatttaggg
atagaattatttgtactggatgatggttggtttggtcataggaaagatgacaaaagttct
ctgggtgattgggtaacagatagaagtcgccttcctgaaggtattggatttcttgcagat
gaaattcacaaaataggtttacaatttggtttgtggtttgagcctgaaatgatttctatt
gatagtgatttgtacaagaatcatgccgattggactatccatttgttagacagagagaag
tcagtaggaagaaatcaatatgtgttggatttgacgagacaggaagttgttgattatctt
tttgattctatttctaaaatcataatcaaaacaaatctggattatatcaaatgggatatg
aatcgtcatataacagatatttatagtattgaacttgattctgaacagcagatggaattt
ggtcatcgatatatcttaggtctttatcagttattagatcgtttaataactaagttccct
tcagttctatttgaatcttgttcttcaggtggtggacgttttgatttaggacttatgtat
tatgcaccgcaagcgtggacgagtgatgatacggacccgatagaaagattgaaaattcag
catggaacttcttatggatattctccatcaatgatgacagcccatgtttctatttctcca
aatgaacaaagtggaagacaaacgagtttggacactaggacaaatgtagcttattttagt
tctttcggttatgaattagatgttacgagattgtcggtagaagaaaaagaacaagtgaga
gaacaaattcagttttataaaaaatatcgttcattgcttcaatatggggatttctatagg
ataaacagtccttttagttgtgattctgctagttggcaagttgtttcaaaagataaatgc
caatcgattttattgtatgctcaattgaatagtaagttgaatccaggttatacaagagtt
tattttagtggtttagataaagataaatgctattccgtctctggatttgatgagttcttt
tatggagatgaattaatgaatgctggaataaaagtaagtttaagtaatttagcactttgt
gttccagaatatcttacaaaattatttgttattgaagaagttgtatgtaaatattga

DBGET integrated database retrieval system