KEGG   Streptococcus pneumoniae 70585: SP70585_2311Help
Entry
SP70585_2311      CDS       T00872                                 

Definition
(GenBank) alpha-glycerophosphate oxidase (Glycerol-3-phosphateoxidase) (Exported protein 6)
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
snm  Streptococcus pneumoniae 70585
Pathway
snm00564  Glycerophospholipid metabolism
snm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SP70585_2311
Enzymes [BR:snm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SP70585_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACO17599
UniProt: C1CBG1
Position
complement(2126838..2128664)
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKSDPMLLPVYDEDGATFSLFRL
KVAMDLYDLLAGVSNTPTANKVLSKDQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKV
RNLSNKGTQFSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFDNLIATVESYLSKEKTREDVESAVSKLESSTSEKYLDPSAVSRGSSLDR
DDNGLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAHYLANLYGSNAPKVFALAHSLEQAPGLSLADTLSLHYAMR
NELALSPVDFLLRRTNHMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKATYRADVEAALAN
NDLAELKN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaattgtcaattaaaaaaatgcaggaacgcaccctg
gacctcttgattatcggtggaggaatcacaggagctggtgtagccttgcaggcggcagct
agcggtcttgagactggtttgattgaaatgcaagactttgcagaaggaacatctagtcgt
tcaacaaaattggttcacggaggtcttcgctacctcaaacaatttgacgtagaagtggtc
tcagatacggtttctgaacgtgcagtggttcaacaaatcgctccacacattccaaaatca
gatccaatgctcttaccagtttacgatgaagatggagcaacctttagcctcttccgtctt
aaagtagccatggacttgtacgacctcttggcaggtgttagcaacacaccaactgcgaac
aaggttttgagcaaggatcaagtcttggaacgccagccaaacttgaagaaggaaggcttg
gtaggaggtggagtgtatcttgacttccgtaacaacgatgcgcgtctcgtgattgaaaac
atcaaacgtgccaaccaagacggtgccctcattgccaaccacgtgaaggcagaaggcttc
ctttttgacgaaagtggcaagattacaggtgttgtagctcgtgatctcttgacagaccaa
gtatttgaaatcaaggcccgtctggttattaatacaacaggtccttggagtgataaagta
cgtaatttgtctaataagggaacgcaattctcacaaatgcgcccaactaagggagttcac
ttggtagtagattcaagcaaaatcaaggtttcacagccagtttactttgacacaggtttg
ggtgacggtcgtatggtctttgttctcccacgtgaaaacaagacttactttggtacaact
gatacagactacacaggtgatttggagcatccaaaagtaactcaagaagatgtagattat
ctacttggcattgtcaacaaccgctttccagaatccaacatcaccattgatgatatcgaa
agcagctgggcaggtcttcgtccattgattgcagggaacagtgcctctgactataatggt
ggaaataacggtaccatcagtgatgaaagctttgacaacttgattgcgactgttgaatct
tatctctccaaagaaaaaacacgtgaagatgttgagtctgctgtcagcaagcttgaaagt
agcacatctgagaaatatttggatccatctgcagtttctcgtgggtctagcttggaccgt
gatgacaatggtcttttgactcttgctggcggtaaaatcacagactaccgtaagatggct
gaaggagctatggagcgcgtggttgacatcctcaaagcagaatttgaccgtagctttaaa
ttgatcaattctaaaacttaccctgtttcaggtggagaattgaacccagcaaatgtggat
tcagaaatcgaagcctttgcgcaacttggagtatcacgtggtttggatagcaaggaagct
cactatctggcaaatctttacggttcaaatgcaccgaaagtctttgcacttgctcacagc
ttggaacaagcgccaggactcagcttggcagatactttgtcccttcactatgcaatgcgc
aacgagttggctcttagcccagttgacttccttcttcgtcgtaccaaccatatgctcttt
atgcgtgatagcttggatagcatcgttgagccagttttggatgaaatgggacgattctat
gactggacagaagaagaaaaagcaacttaccgtgctgatgtcgaagcagctctcgctaac
aacgatttagcagaattaaaaaattaa

DBGET integrated database retrieval system