KEGG   Starkeya novella: Snov_0096Help
Entry
Snov_0096         CDS       T01258                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sno  Starkeya novella
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sno00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(86575..87795)
Genome map
AA seq 406 aa AA seqDB search
MRHFPEPTAPQRSTRVAGLRPAPSRLRRHHPNFEIREMQGWRSLEAEEKLSENGWRKEQQ
WALDMGLPGADSITDKSIPTFARGELPHFAGINTFLKAPYVENVRDVGKYDAAVLGIPFD
SGTTYRPGTRFGPQGIRRISALYTPYNYELGIDLREQMTLCDAGDVFTIPANLEKSFDQI
SKGVSHVFSSGALPIMLGGDHSIGFPCVRGIAECTSKRIGIIHFDRHIDIQEKDLDERMH
TTPWYWATNLPNVSPKNLVQLGIGGWQVPRYGVQEARKRGTNVLTIDDIEKIGLEKTAEI
ALELAWKDADAVYISFDVDSIDCGFVPGTGWPEPGGFLPREALKILGLVAAEGLCGLEVV
EVSPPYDTSDITALFGLRVVVEALGSMVAHGKLGSHRHMIDKPVSF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatttccccgaacctaccgccccccagcgttccacccgtgtcgcgggcctgcgc
cccgccccgtcgcgcctgcgccggcatcatcccaatttcgagatcagggagatgcagggc
tggcgctcgctcgaagccgaggagaagctctccgagaatggctggcgcaaggaacagcaa
tgggcgctcgacatgggcctgccaggcgccgattccatcaccgacaagtcgatcccgacc
ttcgcgcgtggcgaacttccgcacttcgccggcatcaacaccttcctcaaggcgccctat
gtcgagaatgtccgcgacgtcggcaaatatgacgccgccgtgctgggcatcccgttcgac
agcggcacgacctatcgccccggcacccgcttcgggccgcagggcatccgccgtatctcg
gcgctctacacgccctataattacgaactcggcatcgacctgcgcgagcagatgacgctc
tgcgacgccggcgacgtgttcaccatccccgccaatctcgagaagagcttcgaccagatc
tccaagggtgtttcccacgtcttctcgtccggcgcgctgccgatcatgctcggcggcgac
cattccatcggctttccctgcgtgcgggggatcgccgaatgcacctccaaacgcatcggt
atcatccatttcgaccgccacatcgacatccaggagaaggatctcgacgagcgcatgcac
accacgccctggtactgggcgacgaacctgccgaacgtctcgccgaagaacctcgtgcag
ctcggcatcggtggctggcaggttccgcgctacggggtgcaggaggcgaggaagcgtggc
accaacgtcctgaccatcgacgacatcgagaagatcgggctcgagaagaccgccgagatc
gcgctggagctggcgtggaaggatgcggacgcggtctacatctccttcgacgtggacagc
atcgattgcggcttcgtgcccggcaccggctggccggagcccggcggcttcctgccgcgc
gaggcgctgaagatcctcgggctggtggccgccgagggcctatgcgggctggaggtcgtg
gaggtctccccgccctacgacacctccgacatcaccgctttgttcggcctgcgcgtcgtc
gtcgaggcgctcggctcgatggtggcgcacggcaagctcggctcgcaccggcacatgatc
gacaagccggtgagtttctag

DBGET integrated database retrieval system