KEGG   Starkeya novella: Snov_0116Help
Entry
Snov_0116         CDS       T01258                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sno  Starkeya novella
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sno00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sno00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(111706..112791)
Genome map
AA seq 361 aa AA seqDB search
MHAAAHASPLLREPFGTLSDGRAVERIRLAGEGGFEVAIITHGAAVQALHVPDRDGRLAD
IVLGHDDLAPYEAHRRYFGAAVGRYANRIAGGRFPLDGTTCQVPANNGANALHGGPDGFD
RRLWSVEALADGSVPSVTLGLTSPDGDQGFPGELDVRVTYALTGPRELSIAFEATTSRPT
IVNLTHHGFFNLAGVEAGGDVLGHELTLHADAYLPIDAAAIPVGGPTPVAGTPFDFRIPR
LIGGRIREAHEQLRLGRGYDHNFCVAGGRTAEPRLAARVEHPASGRVLELLTDQPGLQFY
SGNFLDGTTEGKFRRLHRQSDAFCLEPQAWPDTPNRPNFPSARLDPGETYRHVSLYRFST
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcacgctgccgcccatgcgtcccccctcctccgcgaacccttcggaaccctgtccgac
gggcgggcggtcgagcgcatccgcctcgccggcgagggcggtttcgaggtcgcgatcatc
acccatggtgcggccgtgcaggccttgcatgtacccgaccgcgacggccgcctcgccgac
atcgtgctcggccatgacgacctcgccccctatgaagcgcaccggcgctatttcggcgcc
gcggtggggcgctatgccaatcgcatcgccggcggccgcttcccgctcgacggtaccacc
tgccaagtccccgccaataacggcgccaacgcgctgcatggcggcccggacggcttcgac
cgccggctctggagcgtcgaggcgctggccgacgggtccgtcccctccgtgacgctcggc
ctcaccagtcccgatggcgaccagggttttccgggcgaactcgatgtccgcgtcacctat
gcgctcaccgggccccgcgaactctccatcgccttcgaggcgacgaccagccggccgacc
atcgtcaacctcacccatcatggcttcttcaacctcgccggcgtcgaagccggcggcgac
gtgctcggccacgagctgaccctccacgccgacgcctatctgccgatcgacgccgcggcg
atcccggtcggtggccctacacccgtcgccggcacgcccttcgatttccgcatcccccgg
ctgatcggcgggcggatacgagaagcgcacgagcaactccggctcgggcgtggctacgac
cacaatttctgcgtcgccggcggccggaccgccgagccgcgcctcgccgcccgcgtcgag
catcctgcgtccggccgcgtcctggaacttctgaccgaccagccgggcctgcaattctac
tcaggcaatttcctcgacggcacgacggaggggaagttccgccggctgcaccgccagtcc
gacgccttctgcctcgagccgcaggcgtggccggacacgccgaaccggccgaacttcccc
tcggcccgcctcgaccccggcgagacctaccgccacgtctcgctctaccgattttcgacc
gtctga

DBGET integrated database retrieval system