KEGG   Starkeya novella: Snov_0252Help
Entry
Snov_0252         CDS       T01258                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
sno  Starkeya novella
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Snov_0252
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Snov_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
242343..242984
Genome map
AA seq 213 aa AA seqDB search
MDGFELNKIAGAVLGVLTFTVGLNVFSDILFTTHAPEKPGFEIAVQEASSGSAQAAAPAD
VPIAQLLATASVEKGAAQAKKCAACHNFQEGAGAKVGPDLYAVVGRAVASAPGFAYSAAM
KAHGGEWTFEQLNNFIKNPKADIPGTAMGFAGIAKESERADLLVYLNTLSHNPLPLPKPE
EAAPAAAPAAAPAGEKPAEPAPAAPAPAAPAHP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacggcttcgagctgaacaagattgctggtgcggtgctgggcgtgctgaccttcacg
gtcggcctgaacgtgttctccgacatcctgttcaccacccacgccccggagaagcccggc
ttcgagatcgccgtgcaggaggcttcctccggctccgctcaggctgccgctcccgccgat
gtgccgatcgcccagctgctcgccaccgccagcgtcgagaagggcgccgcgcaggccaag
aagtgcgccgcctgccacaatttccaggagggcgccggcgccaaggtcggtcccgacctc
tatgccgtcgtcggccgtgcggtcgccagcgcgccgggcttcgcctattccgcggcgatg
aaggcgcatggcggcgagtggaccttcgagcagctcaacaatttcatcaagaacccgaag
gcggacattcccggcacggccatgggctttgccggcatcgccaaggagagcgagcgcgcc
gacctgctggtctacctgaacacgctctcgcacaacccgctgccgctgcccaagcccgaa
gaggccgcgcccgccgctgccccggccgccgctcctgcgggcgagaagccggccgaaccg
gctcccgcggctccggctcccgccgctcctgcccatccttga

DBGET integrated database retrieval system