KEGG   Starkeya novella: Snov_0252Help
Entry
Snov_0252         CDS       T01258                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
sno  Starkeya novella
Pathway
sno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sno00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Snov_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ADH87587
JGI: Snov_0252
UniProt: D7A1X1
Position
242343..242984
Genome map
AA seq 213 aa AA seqDB search
MDGFELNKIAGAVLGVLTFTVGLNVFSDILFTTHAPEKPGFEIAVQEASSGSAQAAAPAD
VPIAQLLATASVEKGAAQAKKCAACHNFQEGAGAKVGPDLYAVVGRAVASAPGFAYSAAM
KAHGGEWTFEQLNNFIKNPKADIPGTAMGFAGIAKESERADLLVYLNTLSHNPLPLPKPE
EAAPAAAPAAAPAGEKPAEPAPAAPAPAAPAHP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacggcttcgagctgaacaagattgctggtgcggtgctgggcgtgctgaccttcacg
gtcggcctgaacgtgttctccgacatcctgttcaccacccacgccccggagaagcccggc
ttcgagatcgccgtgcaggaggcttcctccggctccgctcaggctgccgctcccgccgat
gtgccgatcgcccagctgctcgccaccgccagcgtcgagaagggcgccgcgcaggccaag
aagtgcgccgcctgccacaatttccaggagggcgccggcgccaaggtcggtcccgacctc
tatgccgtcgtcggccgtgcggtcgccagcgcgccgggcttcgcctattccgcggcgatg
aaggcgcatggcggcgagtggaccttcgagcagctcaacaatttcatcaagaacccgaag
gcggacattcccggcacggccatgggctttgccggcatcgccaaggagagcgagcgcgcc
gacctgctggtctacctgaacacgctctcgcacaacccgctgccgctgcccaagcccgaa
gaggccgcgcccgccgctgccccggccgccgctcctgcgggcgagaagccggccgaaccg
gctcccgcggctccggctcccgccgctcctgcccatccttga

DBGET integrated database retrieval system