KEGG   Starkeya novella: Snov_0412Help
Entry
Snov_0412         CDS       T01258                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sno  Starkeya novella
Pathway
sno00220  Arginine biosynthesis
sno00250  Alanine, aspartate and glutamate metabolism
sno00471  D-Glutamine and D-glutamate metabolism
sno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Snov_0412
   00220 Arginine biosynthesis
    Snov_0412
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Snov_0412
Enzymes [BR:sno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Snov_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase DUF4394
Motif
Other DBs
NCBI-ProteinID: ADH87745
JGI: Snov_0412
UniProt: D7A327
Position
417458..418441
Genome map
AA seq 327 aa AA seqDB search
MHGPDAVIPAIPQPKVTNPVPDLERIVSDIAEEMRARPDRGEVATYIPELARADPNAFGI
AVIAADGQVAVGGDADVPFSIQSVSKVFTLTLALGKIGNLLWKRVGREPSGSPFNSIVQL
EAEHGIPRNPFINAGAIAVTDVILSGHQPREALGEILRFMHFLAEDSSIGIDEAVAASEQ
RTGFRNRALANYMKSFDVLENPVDYTLGVYFHHCAIAMSCRQLAMAARFLAHGGRNPSTG
FSVVSAERARRINAIMLTCGHYDGSGEFAYRVGLPGKSGVGGGILAIAPGKASIAVWSPG
LDASGNSHLGRIALEALTQRLGWSVFG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgggccggatgcggtaatccccgccatcccgcagccgaaggtgacgaaccccgtg
cccgatctcgaacgcatcgtcagcgacatcgccgaggagatgcgcgcccgcccggaccgc
ggcgaggtcgcgacctatatccccgagctcgcccgtgccgaccccaatgccttcggcatc
gccgtcatcgcggcggacgggcaggtggcagtgggcggcgacgccgacgtgcccttctcc
atccagagcgtctccaaggtgttcacgctcactttggcgctgggcaagatcggcaacctg
ttgtggaagcgggtggggcgcgagccctcgggcagcccgttcaactccatcgtccagctg
gaggccgagcacggcatcccgcgcaaccccttcatcaatgccggtgccatcgcggtgacc
gacgtcatcctttccggccaccagccgcgcgaggcgctgggcgagatcctgcgcttcatg
cacttcctcgctgaggacagttcgatcggcatcgacgaggcggtcgccgcctccgagcaa
cggaccggcttccgcaaccgggcgctcgccaactacatgaagtcgttcgacgtgctggag
aacccggtcgactacacgctgggcgtctatttccaccactgcgccatcgccatgagctgc
cggcagctcgccatggccgcgcgcttcctcgcccatggcgggcgcaatccgtcgaccggc
ttctcggtggtgtccgcggagcgggcgcggcgcatcaacgccatcatgctcacctgcggc
cactatgacggctcgggcgagttcgcctaccgcgtcggcctgccgggaaagagcggggtg
gggggaggcatccttgccatcgccccgggcaaggcgtcgatcgcggtgtggtcgccgggg
ctcgacgccagcggcaattcgcatctcggccgcatcgcgctggaggcactgacccagcgg
ctcggctggtcggtgttcggctga

DBGET integrated database retrieval system