KEGG   Starkeya novella: Snov_0580Help
Entry
Snov_0580         CDS       T01258                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sno  Starkeya novella
Pathway
sno00071  Fatty acid degradation
sno00280  Valine, leucine and isoleucine degradation
sno00281  Geraniol degradation
sno00310  Lysine degradation
sno00360  Phenylalanine metabolism
sno00362  Benzoate degradation
sno00380  Tryptophan metabolism
sno00410  beta-Alanine metabolism
sno00627  Aminobenzoate degradation
sno00640  Propanoate metabolism
sno00650  Butanoate metabolism
sno00903  Limonene and pinene degradation
sno00930  Caprolactam degradation
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Snov_0580
   00650 Butanoate metabolism
    Snov_0580
  Lipid metabolism
   00071 Fatty acid degradation
    Snov_0580
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snov_0580
   00310 Lysine degradation
    Snov_0580
   00360 Phenylalanine metabolism
    Snov_0580
   00380 Tryptophan metabolism
    Snov_0580
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snov_0580
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Snov_0580
   00281 Geraniol degradation
    Snov_0580
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Snov_0580
   00627 Aminobenzoate degradation
    Snov_0580
   00930 Caprolactam degradation
    Snov_0580
Enzymes [BR:sno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Snov_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ADH87913
JGI: Snov_0580
UniProt: D7A493
Position
complement(613449..614222)
Genome map
AA seq 257 aa AA seqDB search
MAYDNILVETNGRVGVITLNRPKALNALNAALIAELGRALDIFEADAGIGCIVLTGSDRA
FAAGADIKEMQALTFPGTYVDDFITSWERLSRCRKPVVAAVAGYALGGGCEIAMMCDIIL
AADNARFGQPEIQLGIMPGAGGSQRLTRAVGKAKAMEMCLTGRTLTAEEADRYGLVSRVV
PLASLREEAMKVADVIAGLSLPAMMMAKESVNRALETTLAEGIRFERRLFQALFATADQK
EGMAAFADKRGASFQNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgacaacatcctcgtcgagaccaacgggcgcgtcggcgtcatcacgctgaac
cggccgaaggcgctcaacgcgctcaacgccgcgctgatcgccgagctcggccgggcgctc
gacatcttcgaggcggatgccggcatcggctgcatcgtgctgaccggctcggaccgcgcc
ttcgccgccggcgccgacatcaaggagatgcaggcgctcaccttcccggggacctacgtc
gacgacttcatcacctcctgggagcggctgtcgcgctgccgcaagccggtggtggcggcg
gtggcgggctatgcgctgggcggcggctgcgagatcgccatgatgtgcgacatcatcctc
gccgccgacaatgcccgcttcggccagccagagatccagctcggcattatgccgggcgcg
ggcggctcgcagcgtctcacccgcgcggtcggcaaggccaaggcgatggagatgtgcctc
accgggcgcacgctgaccgccgaggaggccgaccgctacggcctcgtctcgcgcgtcgtg
ccgctggcctcgctgcgcgaggaggcgatgaaggtcgccgacgtcatcgccggcctgtcg
ctgccggcgatgatgatggccaaggagagcgtcaaccgggcactcgagaccacgctggcc
gagggcatccgattcgagcgccggctgttccaggcgctgtttgccacggccgaccagaag
gagggcatggccgccttcgccgacaagcgcggcgcctcgttccagaaccgctaa

DBGET integrated database retrieval system