KEGG   Starkeya novella: Snov_0592Help
Entry
Snov_0592         CDS       T01258                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sno  Starkeya novella
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Snov_0592
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Snov_0592
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Snov_0592
Enzymes [BR:sno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Snov_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
623587..624996
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGEAPVLAFSDALLAGLARDGGLYVPETFPALAPADIARLAGRPYAEAACKVIT
PFVDEVFTPEVLRPMLDEAYASFRHPATTPLVQIAPNRFVLELFHGPTLAFKDVAMQLLG
RMMDHVLTQRDQRATIVGATSGDTGSAAIEAFRGRARTDVFILYPAGRVSEVQRRQMTTV
PDANVHAIAVEGTFDDCQAHVKGMFNHHAFRDRLRLAGVNSINWARIVAQVVYYFVAGAA
LGAPHRPVSFVVPTGNFGDVLAGFVAKRMGLTVDRLVIATNVNDILARTLASGRYEVTGV
VPSSSPSMDIQVSSNFERVLFEALDRDAGALRGLMAALNQSGAFSPSNRALEAIRADFDA
GRTDEAQTAETIARVRRETSYLLDPHSAVAVSVAERIQHDPRVPQVVLSTAHPAKFPDAV
ERACGERPALPPHLADLMEREERTPTLPNDIAAIEAYISRHARAAEPAL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctacatctcgacccgcggcgaagcccccgtgctcgccttctccgacgcgctgctc
gccggccttgcgcgcgacggcggcctctatgtgcccgagaccttcccggcgctcgcgccg
gccgacatagcgcgcctcgccggccggccctatgccgaggcagcgtgcaaggtgatcacg
cccttcgtcgacgaggtgttcaccccggaggtgctgcgcccgatgctcgacgaggcctat
gcgagcttccgccacccggcgacgacgccgctggtgcagatcgcccccaaccgcttcgtg
ctggagctgttccacggtccgacgctcgccttcaaggacgtggcgatgcagctgctcggg
cgcatgatggatcatgtgctgacccagcgcgatcagcgcgccacaatagtcggcgccacc
tccggcgatacgggcagcgccgccatcgaggcgttccgcggacgcgcccgcaccgacgtg
ttcatcctctatcccgccggccgcgtctccgaggtgcagcgccggcagatgacgacggtg
ccggacgccaatgtccacgccatcgccgtcgagggcaccttcgacgactgccaggcgcat
gtgaaggggatgttcaaccatcacgccttccgcgaccggctgcgcctcgccggcgtgaac
tcgatcaactgggcgcgcatcgtcgcgcaggtcgtctactatttcgtcgccggcgccgcg
ctcggcgcgccgcatcggccggtctccttcgtggtgccgaccggcaatttcggcgacgtg
ctcgccggcttcgtcgccaagcgcatgggcctcaccgtcgaccggctggtgatcgctacc
aatgtcaacgacatcctcgcccgcacgctggcctccggccgctacgaggtgaccggcgtg
gtgccgtcctcctcgccgtcgatggacatccaggtctcgtcgaatttcgagcgcgtgctg
ttcgaggcgctggaccgcgacgccggcgcgctgcggggcctgatggcggcattgaaccag
tccggcgccttctcgccgtccaaccgggcgctggaggcgatccgcgccgatttcgacgcc
ggccgcaccgacgaggcgcagaccgccgagaccatcgcccgcgtgcgccgcgagaccagc
tacctgctcgacccgcattcggccgtcgccgtctcggtcgccgagcgcatccagcacgac
ccgcgcgtgccgcaggtggtgctctcgaccgcccatccggcgaagttccccgacgcggtg
gagcgcgcctgcggcgagcgtccggcgctgccgccgcacctcgccgatctgatggagcgt
gaggagcgcacgccgaccctgcccaacgacatcgccgccatcgaggcctatatctcccgc
cacgcccgcgccgcggagcccgccctgtga

DBGET integrated database retrieval system