KEGG   Starkeya novella: Snov_0657Help
Entry
Snov_0657         CDS       T01258                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sno  Starkeya novella
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Snov_0657
Enzymes [BR:sno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Snov_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
692731..693282
Genome map
AA seq 183 aa AA seqDB search
MPREAPPEFFVRRPRKVEKRIAYLCLGSNLGDRAGTIAKAVGLIARTGLKIIARSSLYET
PPWGPVLQGPYLNMVVAVETELSARELLNMLLGVEHAFGRDRTREVRFGPRTIDIDILLF
GEDVIAEPDLEIPHPRMMQRAFALIPLAELAPDLVVQGGPIRTALEALDRSGIVKVEPQP
AGY
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtgaggcgccgcccgaattcttcgtccgccgcccgcgcaaggtcgagaagcgc
atcgcctatctctgcctcggctccaatctcggcgaccgcgccgggaccattgcgaaggcg
gtggggctgatcgcccgcaccgggctgaagatcatagcccgctcctcgctctacgagacg
ccgccttgggggccggtgctgcaggggccgtatctgaacatggtggtggcggtggagacc
gagctctcggcgcgggaactgctcaacatgctgctcggcgtcgagcacgccttcgggcgc
gaccgcacccgcgaggtgcgcttcgggccgcgtaccatcgacatcgacatcttgctcttc
ggcgaagacgtgatcgccgagccggatctcgagatcccgcatccgcgcatgatgcagcgc
gccttcgcgctgatcccgctggccgaactggcgcccgacctcgtggtgcagggggggccc
atccgcacggctctggaggcgctcgaccgcagcggtatcgtcaaggtcgagccgcagccg
gcgggttactga

DBGET integrated database retrieval system