KEGG   Starkeya novella: Snov_0814Help
Entry
Snov_0814         CDS       T01258                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sno  Starkeya novella
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snov_0814
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snov_0814
   00630 Glyoxylate and dicarboxylate metabolism
    Snov_0814
Enzymes [BR:sno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Snov_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(839273..841450)
Genome map
AA seq 725 aa AA seqDB search
MSHTDVAGLKVDTALYDFINNEVIPDTGVVAAAFWNGFAGVVGTFAPRNAELLARRDELQ
AQIDAWHRAHRNKPVDPVAYEVFLAEIGYLLPEPEPFEVVTAKVDDELARIPGPQLVVPV
TNARYALNAANARWGSLYDALYGTDALPEANGASRSNGFNPVRAQRVIERARAFLDESVP
LAAGSHADVAAYRVNEGKLVAELKNGRTIGLKDASQFAGSSGEAGAPSSILLVNNGLHID
VLIDRHHRIGKTDPAGIADIVIEAAVTTIVDCEDSVAAVDAEDKVLVYRNWLGLMKGTLS
ASFAKGRETVERSLAADRHYTAADGSTLTLHGRSLMLVRNVGQHMMTDAVLDADGNEIPE
TVLDAAVTSLIALHDLKGTGRLRNSRTGSVYIVKPKMHGPDEVAFACELFAAVEKVLGLE
TNTLKIGIMDEERRTSANLSAAIRAARERVVFINTGFLDRTGDEIHTSIEVGPMVRKNEM
KAQAWIKAYEDNNVDAGLEAHLDGHGQIGKGMWAMPDRMADMLQQKIAHPLAGANTAWVP
SPTAATLHALHYHKVDVFKRQEELRLRPRASKHDLLTIPVVDRGNWEPAAVQEELDNNIQ
GILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHVANWLLHGVVTEAQVEETLR
RMAKVVDAQNEGDPLYEPMAPAYDGVAFRAARDLVFEGRTQPNGYTEFILTARRREAKQA
QAAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagccataccgacgtcgccggcctgaaggtggacaccgcgctgtatgacttcatcaat
aatgaagtcataccagacacgggggtcgtggccgccgccttctggaatggctttgccggg
gtggtcggcaccttcgcgccgcgcaacgccgagctgctcgcgcgccgcgacgagttgcag
gcgcagatcgacgcctggcaccgcgcccaccgcaacaagccggtcgatcccgtcgcctac
gaggtgttcctggccgagatcggctacctgctgccggagcccgagcccttcgaggtcgtc
accgcgaaggtggacgacgagctcgcccgcattcccggcccgcagctcgtggtgcccgtc
accaatgcccgctacgcgctgaacgcggcgaatgcccgctggggcagcctctatgacgcg
ctctatggcaccgacgccctgcccgaggccaatggcgccagccgctccaacggcttcaac
cccgtgcgcgcccagcgcgtgatcgagcgcgcccgcgccttcctcgacgagagcgtgccg
ctcgccgccggcagtcatgccgatgtcgccgcctatcgcgtcaacgagggcaagctggtc
gccgagctgaagaacggccgcaccatcggcctgaaggacgccagccagttcgccggctcc
agcggcgaggcgggcgcgccctcctccatcctgctggtcaataacggcttgcacatcgac
gtgctgatcgaccgccaccaccgcatcggcaagaccgacccggcgggcatcgccgacatc
gtcatcgaggcggcggtcaccaccatcgtcgactgcgaggacagcgtcgcggcggtcgat
gccgaggacaaggtgctggtctatcgcaactggctcggcctgatgaagggcacgctcagc
gccagcttcgccaagggccgcgagacggtggagcgtagcctcgccgccgaccgccactac
accgccgccgacggctccacgctcaccctgcacgggcgcagcctgatgctggtgcgcaat
gtcggccagcacatgatgaccgacgcggtgctggacgccgacggcaacgagatccccgag
accgttctcgacgcggcggtcacctcgctgatcgcgctgcacgacctcaagggcaccggc
cggctgcgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccg
gacgaggtcgccttcgcctgcgagctgttcgccgcggtcgagaaggtgctcggcctcgag
accaacacgctgaagatcggcatcatggacgaggagcgccgcaccagcgccaacctctcc
gccgccatccgcgccgcccgcgagcgcgtcgtcttcatcaacaccggcttcctcgaccgc
accggcgacgagatccacacctcgatcgaggtgggcccgatggtgcgcaagaacgagatg
aaggcgcaggcctggatcaaggcctatgaggacaacaacgtcgatgcgggcctcgaagcc
catctcgacggccacggccagatcggcaagggcatgtgggcgatgcccgaccgcatggcc
gacatgctccagcagaagatcgcccacccgctggccggcgccaacaccgcctgggtgccc
tcgccgaccgccgccacgctgcacgcgctgcactaccacaaggtggacgtgttcaagcgc
caggaggagttgcgtttgcgtccccgcgcctcgaagcacgacctgctgaccatcccggtc
gtcgaccgcggcaattgggagccggcggcggtgcaggaggagctcgacaacaacatccag
ggcatcctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgccg
gacatccacgatgtcgggctgatggaagaccgcgccacgctgcgcatctcctcccagcac
gtcgccaactggctgctgcacggcgtggtcaccgaggcgcaggtcgaggagacgctgcgc
cgcatggccaaggtcgtcgatgcgcagaacgagggcgatccgctctacgagccgatggcc
cccgcctatgacggcgtcgccttccgtgccgcgcgcgacctggtcttcgagggccgcacg
cagcccaacggctacaccgagttcatcctgaccgcccgccgccgcgaggccaagcaggcc
caggccgcggcggcctga

DBGET integrated database retrieval system