KEGG   Starkeya novella: Snov_0814Help
Entry
Snov_0814         CDS       T01258                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sno  Starkeya novella
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snov_0814
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snov_0814
   00630 Glyoxylate and dicarboxylate metabolism
    Snov_0814
Enzymes [BR:sno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Snov_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(839273..841450)
Genome map
AA seq 725 aa AA seqDB search
MSHTDVAGLKVDTALYDFINNEVIPDTGVVAAAFWNGFAGVVGTFAPRNAELLARRDELQ
AQIDAWHRAHRNKPVDPVAYEVFLAEIGYLLPEPEPFEVVTAKVDDELARIPGPQLVVPV
TNARYALNAANARWGSLYDALYGTDALPEANGASRSNGFNPVRAQRVIERARAFLDESVP
LAAGSHADVAAYRVNEGKLVAELKNGRTIGLKDASQFAGSSGEAGAPSSILLVNNGLHID
VLIDRHHRIGKTDPAGIADIVIEAAVTTIVDCEDSVAAVDAEDKVLVYRNWLGLMKGTLS
ASFAKGRETVERSLAADRHYTAADGSTLTLHGRSLMLVRNVGQHMMTDAVLDADGNEIPE
TVLDAAVTSLIALHDLKGTGRLRNSRTGSVYIVKPKMHGPDEVAFACELFAAVEKVLGLE
TNTLKIGIMDEERRTSANLSAAIRAARERVVFINTGFLDRTGDEIHTSIEVGPMVRKNEM
KAQAWIKAYEDNNVDAGLEAHLDGHGQIGKGMWAMPDRMADMLQQKIAHPLAGANTAWVP
SPTAATLHALHYHKVDVFKRQEELRLRPRASKHDLLTIPVVDRGNWEPAAVQEELDNNIQ
GILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHVANWLLHGVVTEAQVEETLR
RMAKVVDAQNEGDPLYEPMAPAYDGVAFRAARDLVFEGRTQPNGYTEFILTARRREAKQA
QAAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagccataccgacgtcgccggcctgaaggtggacaccgcgctgtatgacttcatcaat
aatgaagtcataccagacacgggggtcgtggccgccgccttctggaatggctttgccggg
gtggtcggcaccttcgcgccgcgcaacgccgagctgctcgcgcgccgcgacgagttgcag
gcgcagatcgacgcctggcaccgcgcccaccgcaacaagccggtcgatcccgtcgcctac
gaggtgttcctggccgagatcggctacctgctgccggagcccgagcccttcgaggtcgtc
accgcgaaggtggacgacgagctcgcccgcattcccggcccgcagctcgtggtgcccgtc
accaatgcccgctacgcgctgaacgcggcgaatgcccgctggggcagcctctatgacgcg
ctctatggcaccgacgccctgcccgaggccaatggcgccagccgctccaacggcttcaac
cccgtgcgcgcccagcgcgtgatcgagcgcgcccgcgccttcctcgacgagagcgtgccg
ctcgccgccggcagtcatgccgatgtcgccgcctatcgcgtcaacgagggcaagctggtc
gccgagctgaagaacggccgcaccatcggcctgaaggacgccagccagttcgccggctcc
agcggcgaggcgggcgcgccctcctccatcctgctggtcaataacggcttgcacatcgac
gtgctgatcgaccgccaccaccgcatcggcaagaccgacccggcgggcatcgccgacatc
gtcatcgaggcggcggtcaccaccatcgtcgactgcgaggacagcgtcgcggcggtcgat
gccgaggacaaggtgctggtctatcgcaactggctcggcctgatgaagggcacgctcagc
gccagcttcgccaagggccgcgagacggtggagcgtagcctcgccgccgaccgccactac
accgccgccgacggctccacgctcaccctgcacgggcgcagcctgatgctggtgcgcaat
gtcggccagcacatgatgaccgacgcggtgctggacgccgacggcaacgagatccccgag
accgttctcgacgcggcggtcacctcgctgatcgcgctgcacgacctcaagggcaccggc
cggctgcgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccg
gacgaggtcgccttcgcctgcgagctgttcgccgcggtcgagaaggtgctcggcctcgag
accaacacgctgaagatcggcatcatggacgaggagcgccgcaccagcgccaacctctcc
gccgccatccgcgccgcccgcgagcgcgtcgtcttcatcaacaccggcttcctcgaccgc
accggcgacgagatccacacctcgatcgaggtgggcccgatggtgcgcaagaacgagatg
aaggcgcaggcctggatcaaggcctatgaggacaacaacgtcgatgcgggcctcgaagcc
catctcgacggccacggccagatcggcaagggcatgtgggcgatgcccgaccgcatggcc
gacatgctccagcagaagatcgcccacccgctggccggcgccaacaccgcctgggtgccc
tcgccgaccgccgccacgctgcacgcgctgcactaccacaaggtggacgtgttcaagcgc
caggaggagttgcgtttgcgtccccgcgcctcgaagcacgacctgctgaccatcccggtc
gtcgaccgcggcaattgggagccggcggcggtgcaggaggagctcgacaacaacatccag
ggcatcctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgccg
gacatccacgatgtcgggctgatggaagaccgcgccacgctgcgcatctcctcccagcac
gtcgccaactggctgctgcacggcgtggtcaccgaggcgcaggtcgaggagacgctgcgc
cgcatggccaaggtcgtcgatgcgcagaacgagggcgatccgctctacgagccgatggcc
cccgcctatgacggcgtcgccttccgtgccgcgcgcgacctggtcttcgagggccgcacg
cagcccaacggctacaccgagttcatcctgaccgcccgccgccgcgaggccaagcaggcc
caggccgcggcggcctga

DBGET integrated database retrieval system