KEGG   Starkeya novella: Snov_0825Help
Entry
Snov_0825         CDS       T01258                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sno  Starkeya novella
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sno00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(854522..855178)
Genome map
AA seq 218 aa AA seqDB search
MTERHVPRRHDVLLVVDIQNDFCPGGRLGVPRGDQVVPVVNRMAKRFAHVVLTQDWHPPG
HLSFASSHAGAQPYQTIDVEYGAQILWPDHCVQGTRGAAFRDDLDVPHAELILRKGYHPG
IDSYSAFYENDRRTPTGLASYLRERGFRRVFLAGLAFDFCVRYSAEDARRIGFETVVVED
ACRAIDVDGSAAATRRQFDALGIACITAAAVEGAAAKG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgccacgtcccccgacgccacgacgtccttctggtcgtcgacatccagaac
gatttctgtcccggcggacgtctcggcgtgccgcgcggcgaccaggtcgtgccggtggtc
aaccggatggcgaagcgcttcgcccatgtggtgctgacgcaggactggcacccgccgggc
cacctctccttcgcctcctcgcacgccggcgcgcagccctaccagaccatcgacgtcgag
tacggcgcgcagatcctgtggccggaccattgcgttcagggcacgcgcggcgccgccttc
cgcgacgacctcgacgtgccccatgccgagctcatcctgcgcaagggctaccacccgggg
atcgattcctactccgccttctacgagaacgaccggcgcaccccgaccggcctcgccagc
tatctgcgcgagcgcggcttccgccgggtgttcctcgccggcctcgccttcgacttctgc
gtgcgctattcggccgaggacgcgcggcggatcggtttcgagacggtggtggtcgaggac
gcctgccgcgccatcgacgtcgacggctcggccgccgccacgcgccggcagttcgacgcg
ctcggcatcgcctgcatcaccgcagccgcggtggagggagcggccgcgaagggctga

DBGET integrated database retrieval system