KEGG   Starkeya novella: Snov_0826Help
Entry
Snov_0826         CDS       T01258                                 

Definition
methionine-R-sulfoxide reductase (EC:1.8.4.12)
Orthology
K07305  
peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
sno  Starkeya novella
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
855402..855887
Genome map
AA seq 161 aa AA seqDB search
MLTRRFLMLTGAAGLTAAWLRPGRDARAAETYPVTYTDAEWRQRLTPQQYTVLRKDGTER
PYSSPLNDEHRRGTFACAGCDNELFSSATKFDSGTGWPSFWAPLEKAVGETRDVSFGMVR
TAVHCARCGGHLGHVFDDGPKPTGLRYCMNGVAMTFKPVAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcgacgctttctgatgctgacgggtgccgcgggccttaccgccgcctggctc
cggccggggcgggatgcaagggcggcggagacctatccggtcacttacaccgatgccgaa
tggcgccagcgcctgacgccgcagcaatacaccgtgctgcgcaaggacggcacggagcgg
ccctattccagcccgctgaacgacgagcaccgccgcggcaccttcgcctgcgccggctgc
gacaacgagctgttctcctccgccaccaagttcgacagcggcaccggctggccgagcttc
tgggcgccgctggagaaggcggtgggcgagacgcgcgacgtctccttcggcatggtgcgc
accgccgtccactgcgcccgctgcggcggccatctcggccatgtctttgacgacgggccg
aagccgaccgggctgcgctactgcatgaacggcgtggcgatgaccttcaagccggtcgcg
gcgtga

DBGET integrated database retrieval system