KEGG   Starkeya novella: Snov_1033Help
Entry
Snov_1033         CDS       T01258                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
sno  Starkeya novella
Pathway
sno01100  Metabolic pathways
sno01120  Microbial metabolism in diverse environments
sno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sno00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Snov_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrome_C554
Motif
Other DBs
NCBI-ProteinID: ADH88353
JGI: Snov_1033
UniProt: D7A6X9
Position
1071815..1072219
Genome map
AA seq 134 aa AA seqDB search
MNRFAISFALLALGSTAALAQSPAGDPAKGANVFKKCMACHAVGEGAKNKVGPELNGIIG
RKMGSIEGFNYSDTLKEHNAKGDVWTAEILSQYLANPKGYMPGVKMVFAGLPKETDRADL
EAYLGTFNADGTKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcttcgccatctccttcgccctgctcgcgctgggttccaccgccgcgctggcc
cagagcccggccggcgatcccgccaagggcgccaacgtcttcaagaagtgcatggcctgc
cacgccgtgggcgagggcgccaagaacaaggtcggtcccgagctcaacggcatcatcggc
cgcaagatggggtcgatcgagggcttcaactattccgacacgctgaaggagcacaacgcc
aagggcgatgtgtggactgcggagatcctcagccagtatctggccaatccgaagggctac
atgcccggcgtgaagatggtgttcgctggcctgcccaaggagaccgaccgcgccgatctc
gaggcgtatctcggcacgttcaacgccgacggcaccaagaagtag

DBGET integrated database retrieval system