KEGG   Starkeya novella: Snov_1090Help
Entry
Snov_1090         CDS       T01258                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sno  Starkeya novella
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Snov_1090
Enzymes [BR:sno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Snov_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1123715..1124377
Genome map
AA seq 220 aa AA seqDB search
MTNPPAISVARRGLMLVLSSPSGAGKSTLAQLLLKEHPEMHLSVSVTTRDRRPSEVEGIH
YHFIKRERFEKLRDTGDLLESAEVHGNFYGTPREPVETALAAGKDVLFDIDYQGTLQLYE
KMRADIVGVFILPPSATELKTRLERRAEDASGVIEKRLKNARTEIAHWEEYDYVLVNEDL
NTTFINLQAILSAERLRRQRQLGLAPIIERLDEELAAMTA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacccacccgccatttcggtcgcgcgccgcgggctgatgctggtgctgtcctcg
ccctcgggcgcgggcaagtcgacgctggcccaactgctcctgaaggagcaccccgagatg
cacctctcggtgtccgtcaccacgcgtgaccggcgtccgagcgaggtcgagggcatccac
taccacttcatcaagcgcgagcgcttcgagaagctgcgcgacaccggcgacctgctggaa
tccgccgaagtgcacggcaatttctacggcacgccgcgcgagccggtggagacggcgctg
gcggccggcaaggacgtgctgttcgacatcgactaccaaggcacgctgcagctctacgag
aagatgcgcgccgacatcgtcggcgtgttcatcctgccgccctcggccaccgagctgaag
acgcggctggagcggcgggcggaggacgcctccggcgtgatcgagaagcggctgaagaat
gcccgcaccgagatcgcccactgggaggaatacgactacgtgctggtcaacgaggacctg
aacacgaccttcatcaacctgcaggccattctttccgccgagcgcctgcgccgccagcgc
cagctcggccttgcgcctatcatcgagcggctggacgaggaactggcggcgatgaccgcc
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system