KEGG   Starkeya novella: Snov_1518Help
Entry
Snov_1518         CDS       T01258                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sno  Starkeya novella
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Snov_1518
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Snov_1518
Enzymes [BR:sno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Snov_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1574762..1575715)
Genome map
AA seq 317 aa AA seqDB search
MTSNPLPSFTLSRRHLLGIEGLSPEEIVGLLDLAEEFVVLNRQVEKKRATLRGRTQINLF
FEASTRTQSSFELAGKRLGADVMNMSVSTSSVKKGETLIDTAATLNAMHPDVLIVRHSAS
GAVELLARKVDCSVVNAGDGAHEHPTQALLDALTIRRNKGTIQGLTVAICGDIAHSRVAR
SNILLLQALGAQVRVVAPPTLLPKDIERFGVQVHHDMRRGLADVDIVMMLRLQRERMNGS
FVPSVKEYFHFWGLDEAKLRYAKPDALVMHPGPMNRGVEIDSAVADGAQSLIREQVEMGV
AVRMAVLDALSRNLPNG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgaacccgctgcccagcttcaccctctcccgccggcacctgctcggcatcgag
ggcctgtcgcccgaggaaatcgtcggcctcctcgaccttgccgaggagttcgtcgtcctc
aaccgacaggtcgagaagaagcgcgccacgctgcgcggccgcacccagataaacctgttc
ttcgaggcctcgacgcggacccagtcctccttcgaactcgccggcaagcgcctcggcgcc
gacgtgatgaacatgtcggtcagcacctcctcggtgaagaagggcgagaccctcatcgac
accgcggcgacgctgaacgccatgcacccggacgtgctgatcgtgcgccacagcgcctcc
ggcgccgtcgagctgctggcgcgcaaggtcgactgctcggtggtcaatgccggcgacggt
gcgcatgagcacccaacgcaagcgttgctcgacgcgctgaccatccgccgcaacaaggga
accatccagggcctgacggtcgcgatctgcggcgacatcgcccattcgcgcgtcgcccgt
tccaacatcctgctgctgcaggcgctcggcgcgcaggttcgcgtggtcgccccgccgacg
ctgctgcccaaggacatcgagcgcttcggcgtccaggtgcatcacgacatgcggcgcggc
ctcgccgacgtcgacatcgtcatgatgctgcgcctgcagcgcgagcgcatgaacggctcc
ttcgtcccgtcggtgaaggaatatttccacttctggggcctcgacgaggccaagctgcgc
tacgccaagccggacgcgctggtgatgcatcccggcccgatgaaccggggcgtggagatc
gattcggctgtcgccgacggcgcccagtcgctcatccgcgagcaggtggagatgggcgtc
gccgtgcgcatggccgtgctggacgcgctgtcgcggaatcttcccaatggctga

DBGET integrated database retrieval system