KEGG   Starkeya novella: Snov_1646Help
Entry
Snov_1646         CDS       T01258                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sno  Starkeya novella
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Snov_1646
Enzymes [BR:sno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Snov_1646
Exosome [BR:sno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snov_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1706816..1707877)
Genome map
AA seq 353 aa AA seqDB search
MTIPFARPRAVPTEPSARPDVTSRLDLAQRPRRNRKCEWTRKLVRENTLTVSDLVWPVFV
MDGKATRTPVGSMPGVERLTVDEAVREAERAAKLGIPAIALFPYTDPSLRTVDGREALNH
DNLVCRTLRAIKDAVPEIGLITDVALDPYTSHGHDGLLDAEGRILNDETVSVLIEQALVQ
AEAGADVIAPSDMMDGRVGAIRTALDASGHVEAQILAYSAKYASAFYGPFRDAVGSSGCL
KGDKRTYQMDPANGIEALREAALDIEEGADMLMVKPGLPYLDIVYRLKETFGLPTFAYQV
SGEYAMIEAAARNGWIDGEKAMMESLLAFKRAGADGVLTYFAPRVAEKLAREA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcccttcgcccgtccgcgtgccgtccccaccgagccttcggctcggcccgac
gtcacgtcccggctcgacctggcgcagcgcccccggcgcaatcgcaagtgcgaatggacg
cgcaagctggtgcgggagaacacgctgaccgtctccgacctcgtctggccggtcttcgtg
atggacggcaaggcgacgcgtaccccggtcggctccatgccgggcgtcgagcggctcacc
gtcgacgaggcggtccgcgaggcggaacgggcggcgaagctcggcatcccggctatcgcg
ctgttcccctacaccgatccgtccttgcgcaccgtcgacgggcgcgaggcgctcaaccac
gacaatctcgtctgccgcaccctgcgggcgatcaaggacgcggtgccggagatcggcctc
atcaccgacgtggcgctcgacccctacacgagccacggccatgacgggctgctcgatgcc
gagggccgcatcctcaacgacgagacggtgtccgtgctgatcgagcaggcgctggtgcag
gccgaggccggcgccgatgtgatcgccccctccgacatgatggacgggcgcgtcggcgcc
atccgcaccgcgctcgacgccagcggccatgtcgaggcgcagatcctcgcctacagcgcc
aaatacgcctccgccttctacggcccgttccgcgacgcggtcggctcgtccggctgcctc
aagggcgacaagcgcacctaccagatggaccccgccaacggcatcgaggcgttgcgcgag
gccgcgctcgacatcgaggagggcgcggacatgctgatggtcaagcccggcctgccctat
ctcgacatcgtctaccggctgaaggagaccttcggcctgccgaccttcgcctatcaggtc
tccggcgagtacgcgatgatcgaggccgccgcccgcaatggctggatcgacggcgagaag
gcgatgatggagagcctgttggccttcaagcgcgccggtgccgacggcgtgctcacctat
ttcgccccacgcgtcgccgaaaagctcgcccgcgaggcctga

DBGET integrated database retrieval system