KEGG   Starkeya novella: Snov_1792Help
Entry
Snov_1792         CDS       T01258                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sno  Starkeya novella
Pathway
sno00010  Glycolysis / Gluconeogenesis
sno00020  Citrate cycle (TCA cycle)
sno00620  Pyruvate metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01200  Carbon metabolism
Module
sno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snov_1792
   00020 Citrate cycle (TCA cycle)
    Snov_1792
   00620 Pyruvate metabolism
    Snov_1792
Enzymes [BR:sno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Snov_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ADH89096
JGI: Snov_1792
UniProt: D6ZYI4
Position
complement(1870089..1871465)
Genome map
AA seq 458 aa AA seqDB search
MSIEILMPALSPTMEKGNLAKWLKKEGDKVAPGDVIAEIETDKATMEVEAIDEGTLAKIV
VPEGTADVPVNQIIAVLATEGEDAKAVAAGGAAAPAKAEAPKAEAPKAAGPAPAPAPVAA
APAPAASAPAAPSAVPARAEGERVFASPLARRLAKEKGVDLAAVKGSGPHGRIVAADVGA
APVGAAAPAPAAAAAPAARAPAAAPAPVAPGALLEQVKAYYEAGTYEEVPLDAMRRVIAQ
RMTEARQTVPTFYLTVDCDVDALLKLREELNKSAPEKDGKPAYKLSVNDFVIKAYALAFQ
QVPDANMVWGGDRYLKLKHSDIGVAVAIDGGKGLLTPIIRKAETKTLSAISNETRDFAAR
ARNKKLQPHEYQGGSSAISNLGMFGIKDFTAIINPPHATILAVGTSEQRAVVKGGQLAVA
TVMTVTISCDHRVMDGAMGAQLIGAFKQIIEKPMSMLV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgagatcctgatgccggccctgtctccgaccatggagaagggcaatctggcc
aaatggctgaagaaggagggcgacaaagtcgccccgggcgacgtcatcgccgagatcgag
accgacaaggccacgatggaggtcgaggccatcgatgagggcacactggccaagatcgtg
gtgccggaaggcaccgccgacgtgccggtgaaccagatcatcgcggtgctggcgaccgag
ggcgaggacgcgaaggcggtcgccgccggcggcgccgccgcacccgccaaggcggaggcc
ccgaaggctgaagctcccaaggcagccgggccggcgccggcccctgcgcccgtcgctgcc
gctcccgccccggccgcttctgcgccggccgctccctcggcggttcccgcccgtgccgag
ggcgagcgcgtcttcgcttcgcctttggcccgccgcctcgccaaggagaagggcgtcgac
ctcgccgcggtgaagggctccggcccgcatggccgcatcgtcgccgccgacgtcggggcc
gccccggtcggcgcggctgcgccggcacccgccgccgctgcggctcccgcggccagggcg
cccgccgccgctccggcgcccgttgcccccggcgcgttgctggagcaggtgaaggcctat
tacgaggccggcacctatgaggaagtgccgctcgacgccatgcgccgcgtcatcgcccag
cgcatgaccgaggcccggcagacggtgccgaccttctatctcaccgtcgactgcgacgtc
gacgcgctgttgaagctgcgcgaagaactgaacaagtcggcccccgagaaggacggcaag
ccggcctacaagctctcggtcaacgacttcgtcatcaaggcctatgcgctcgccttccag
caggtgccggacgccaacatggtctggggcggcgaccgctacctcaagctcaagcactcc
gacatcggcgtcgcggtggcgatcgacggtggcaagggcctgctgaccccgatcatccgc
aaggcggagaccaagacgctctcggccatctccaacgagacgcgcgacttcgccgcccgc
gcccgcaacaagaagctgcagccgcacgaatatcagggcggttcgtctgcgatttccaac
ctaggtatgtttggaatcaaggacttcacggcaatcattaatccgccgcatgcgacgatc
ctcgcggtcggcaccagcgagcagcgcgcggtggtgaagggtgggcagctcgcggtggcg
acggtgatgaccgtcaccatctcctgcgatcatcgcgtgatggacggcgccatgggcgcg
cagctcatcggcgccttcaagcagatcatcgaaaagccgatgtcgatgctggtctga

DBGET integrated database retrieval system