KEGG   Starkeya novella: Snov_2018Help
Entry
Snov_2018         CDS       T01258                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sno  Starkeya novella
Pathway
sno00790  Folate biosynthesis
sno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Snov_2018
Enzymes [BR:sno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Snov_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADH89316
JGI: Snov_2018
UniProt: D7A055
Position
2122325..2122963
Genome map
AA seq 212 aa AA seqDB search
MDAVLKSLMRSAQNEVEASAARRPSREEAEAAVRTLIAWAGDDPSREGLLDTPKRVVRAY
EELYSGYRANPEKILDRTFGEIGNFDDMVLVRDIEFYSHCEHHMVPFVGKAHVAYFPVER
VVGLSKIARIVDLFARRLQTQEHLTSQIVTAMDEILKPRGVAVLLEAEHMCMAMRGVRKQ
GASTVTSQFTGVFRDDPQEQVRFMSLLRGMRP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgtgcttaagtcgctgatgcgtagtgcccagaacgaagtcgaagcctccgcc
gcccgccgtccctcccgcgaggaggccgaggcggccgtgcgcacgctgatcgcctgggcc
ggcgacgatccgagccgggaaggcctgctcgacacgcccaagcgcgtcgtgcgcgcctat
gaggagctctacagcggctaccgcgccaatcccgagaagatcctcgaccgcaccttcggc
gagatcggcaatttcgacgacatggtgctggtgcgcgacatcgaattctattcgcactgc
gagcaccacatggtgccgttcgtcggcaaggcgcatgtcgcctatttcccggtcgagcgc
gtggtcggcctgtcgaagatcgcccgcatcgtcgatcttttcgcccgccgcctgcagacg
caggagcacctgacctcgcagatcgtcacggcgatggacgagatcctgaagccccgcggc
gtcgccgtgctgctcgaggccgagcacatgtgcatggccatgcgcggcgtgcgcaagcag
ggcgcttccaccgtgacctcgcagttcaccggcgtgttccgcgacgacccgcaggagcag
gtgcgcttcatgagcctgctgcgcggcatgcgtccttga

DBGET integrated database retrieval system