KEGG   Starkeya novella: Snov_2246Help
Entry
Snov_2246         CDS       T01258                                 

Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
sno  Starkeya novella
Brite
Enzymes [BR:sno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Snov_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2345947..2346903
Genome map
AA seq 318 aa AA seqDB search
MTDKFDPLDSGTIPRFAGLSTFMRLPVAEPSEVDIAILGVPFDLGTTNRAGTRHGPRELR
NQSSLMRRVHHVTGLSPYDRARVADCGDVVIDPFDLMRSLDIITAQYAGVREAGALPLTG
GGDHLITLPILRGLAKDGPVGLIQFDAHSDTYDSFFNCSRYNHGTPFRRAIEEGLVDPKR
FVQIGLRGAISDAGNYDYARSVGVRIIFIEELVARGVEDVMAEARAIVGNKPTYVTFDID
GIDPSQAPGTGTPEIGGFSTREAQQMVRLLDGLDLIGADLVEVAPPFDPSGLTALTGATI
MFELLCVLAGVVESKGTR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagttcgacccgctggattcgggcaccatcccccgcttcgccggcctgtcc
accttcatgcggctgccggtggccgagccttccgaggtcgacatcgccatactcggcgta
cccttcgacctcggcaccaccaatcgcgccggcacccgccacgggccgcgcgaattgcgc
aaccagtcgagcctgatgcgccgcgtgcaccatgtcaccggcctgtcgccctatgaccgc
gctcgcgtcgccgattgcggcgacgtcgtcatcgacccgttcgacctgatgcgctcgctc
gacatcatcaccgcgcagtatgccggcgtgcgcgaggccggcgcgctgccgctcacgggc
ggcggcgaccatttgatcaccctgccgatcctgcggggactggcgaaggacggccccgtc
gggctgatccagttcgacgcccattccgacacctatgacagcttcttcaactgcagccgc
tacaatcacggcacgccgttccgccgcgccatcgaggaagggctggtcgatccgaaacgc
ttcgtgcagatcggcctgcgcggcgcgatctcggatgccggcaattacgactacgcccgc
tccgtgggcgtgcgcatcatcttcatcgaggaactcgtcgcgcgcggcgtcgaggacgtc
atggcggaagcgcgcgccatcgtcgggaacaagccgacctacgtcaccttcgacattgac
ggcatcgacccctcgcaggcgcccggcaccggcacgccggagatcggcggcttctccacc
cgcgaggcgcaacagatggtgcgcctgctcgacgggctcgacctcatcggcgccgacctg
gtcgaagtcgccccgcccttcgacccgtccggcctcaccgcgctgaccggggccaccatc
atgttcgagctgctctgcgtcctcgccggcgtcgtcgagagcaaggggacgcgctga

DBGET integrated database retrieval system