KEGG   Starkeya novella: Snov_2247Help
Entry
Snov_2247         CDS       T01258                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sno  Starkeya novella
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sno00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2346903..2347859
Genome map
AA seq 318 aa AA seqDB search
MAHGYEGGRLDLPFVGICTFGKYPLQLDWDRIDADVAILGAPFDLGTQWRSGARSGPRAI
REASTLFSFGHAGAYDHEDDIVYLPAAATRIVDIGDADMIHTDTLASHANIERGVRKILQ
AGAIPVVLGGDHSVNIPCIEAFSDEEPIHIVQFDAHLDFVDERHGVRRGHGSPLRRAAEK
PYVTGLTQLGIRNVSSTAREGYEAARSMGSDILSVRQIRKLGTEAVLARIPTGVRYYVTI
DIDGFDPSIAPGTGTPSHGGFTYYEVLELLDGLAKRGNVVGVDLVEVAREYDPGGVTAIL
AAQVLLNFIGRVLHHRIS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcccatggctatgaaggcggccggctcgacctgcccttcgtcggcatctgcaccttc
ggcaagtacccgctccagctcgactgggaccgcatcgacgccgacgtcgccatcctcggt
gcccccttcgacctcggcacgcagtggcgctccggcgcccgctccggcccgcgcgcgatc
cgcgaggcgtcgacgctgttctccttcggccatgccggcgcctatgaccatgaggacgac
atcgtctacctgccggcggcggcgacccgcatcgtcgacatcggcgatgccgacatgatc
cacaccgacacgctggcgagccacgccaacatcgaacggggcgtgcgcaagatattgcag
gccggcgccatcccggtcgtgctcggcggcgaccactcggtcaacatcccctgcatcgag
gcgttctcggacgaagagccgatccacatcgtccagttcgacgcccatctcgatttcgtc
gacgagcgccacggcgtgcggcgcggccatggcagcccgctgcggcgggcggcggagaag
ccctatgtcaccgggttgacccagctcggcatccgcaacgtctcctccaccgcccgcgag
ggctacgaggccgcgcggtccatgggctcggacatcctgagcgtcaggcagatccgcaag
ctgggcaccgaggcggtgctggcgcgcatcccgaccggggtgcgctattacgtcaccatc
gacatagacggcttcgacccgtccatcgcccccggcaccggcacgccgagccatggcggc
ttcacctattacgaggtgctggagctgctcgacggccttgcgaaacgcggcaacgtcgtg
ggcgtcgacctcgtcgaggtcgcccgcgaatatgatcccggcggcgtcaccgccatcctc
gccgcgcaggtgctgctgaacttcatcggccgcgtgctgcaccaccgtatctcttga

DBGET integrated database retrieval system