KEGG   Starkeya novella: Snov_2291Help
Entry
Snov_2291         CDS       T01258                                 

Definition
(GenBank) Malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
sno  Starkeya novella
Pathway
sno00410  beta-Alanine metabolism
sno00640  Propanoate metabolism
sno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Snov_2291
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Snov_2291
Enzymes [BR:sno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Snov_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-ProteinID: ADH89586
JGI: Snov_2291
UniProt: D7A2C3
Position
complement(2406646..2408022)
Genome map
AA seq 458 aa AA seqDB search
MDAGTSFFGDLLGTIAERGRALLDIGRERRPAGAIRAAGIADLCERLLSGRGEASGVALA
QEILVAYRTLRTGERVAFFETLANDFGPDAARLEAALAAHVKAPSTRTVAELHGASEPRR
QELVRRLNLAPGATGRLVAMRADLLDALARRPDLADVDRDFVHLFTSWFNRGFLVLRRID
WSTPASVLEKIIRYEAVHEIRDWNDLRARVDSPDRRCYAFFHPALVDEPLIFVEVALTRD
IPEAIAPILEAKRTPLDPANAKTAVFYSISNCQTGLGGVSFGNFLIKQVVEEISREFPKL
TNFVTLSPVPRFRAFVEAERANPASAVLTAEDRAALDAFEAGTGDDEARRTLRPVIEALA
AHYFLVARSAKGKPLDPVARFHLGNGARLERIDPFGDLSPRGMKQALGLMVNYRYVLDDI
EKNHEAFFDRGTIVASPQVKKLLRADSHPVPAVREAAG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgggaacgagcttcttcggcgatctgctcggcaccatagccgagcgcggccgg
gcgctgctcgatatcgggcgcgagcgccggcccgccggcgccatccgcgcggccggcatc
gccgatctgtgcgagcggctgctgtcgggccgtggcgaagcttccggcgtggcgctggcg
caggagatcctcgtcgcctaccgcacgctgcgcaccggcgagcgcgtcgccttcttcgag
acgctggcgaatgatttcggccccgacgccgcccggctggaggcggcgctcgccgcccat
gtgaaggcgccttccacccgcactgtggcggagctgcacggcgccagcgagccgcgccgg
caggaactggtgcgccggctgaacctcgctcccggcgccaccggccggctcgtcgccatg
cgcgcggacctgctcgacgcccttgcgcgccggcccgatctggccgatgtcgaccgcgac
ttcgtgcatctgttcacgtcctggttcaatcgggggttcctcgtgctgcgccgtatcgac
tggtcgacgcccgccagcgtgctggagaagatcatccgctatgaggcggtgcacgagatc
cgcgactggaacgatttgcgtgcccgcgtcgattcaccggaccggcgctgctacgccttt
ttccatccggcgctggtggacgagccgctgatcttcgtcgaggtggcgctcacccgcgac
ataccggaggccatcgcgccgatcctcgaggccaagcgcacgccgctcgacccggcgaat
gcgaagacggcggtgttctattcgatctccaactgccagaccggcctcggcggggtgagc
ttcggcaatttcctcatcaagcaggtggtggaggagatctcccgcgaattccccaagctg
acgaacttcgtcaccctatcgccggtgccgcgcttccgcgccttcgtcgaggcggagcgg
gccaatcctgcctccgccgtcctgaccgccgaggaccgcgccgcgctcgacgccttcgag
gccgggacgggggacgacgaggcgcgccgcacgctgcgcccggtgatcgaggcgctggcg
gcgcactatttcctcgtcgcccgctcggccaagggcaagccgctcgatcccgtcgcgcgc
ttccatctcggcaatggcgcgcgtctggaacgcatcgaccccttcggcgacctgtcgccg
cgcggcatgaagcaggcgctggggctgatggtgaactaccgctatgtgctcgacgacatc
gagaagaaccacgaggcgttcttcgaccgcggcaccatcgtcgccagcccgcaggtgaag
aagctgctgcgggcggatagccacccggtgccggcggtgcgcgaggcggcggggtag

DBGET integrated database retrieval system