KEGG   Starkeya novella: Snov_2709Help
Entry
Snov_2709         CDS       T01258                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sno  Starkeya novella
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Snov_2709
Enzymes [BR:sno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Snov_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2838396..2839367)
Genome map
AA seq 323 aa AA seqDB search
MPSEMILYSTFENPVPEGALCGTVTAVDGVQLRFARWPVAGECRGTVCVFPGRTEKIEKY
FETVRDLLRRGFAVAALDWRGQGGSQRLLRNPMKGHVRDFAEYQLDIDAFMQQAVTPELP
GPYFALAHSMGATILLDHARRGGTLFERMFLIAPMLDISLVKHEATARRAARLLARLGFG
KAYVPRGRRRLRELHFDGNRLTSDAARFARNLTITMEQPQLDVGPPTIGWIKAAYDVMET
LADPATARKIRQPLLMVAAGQDSIVSTPTIEHLGTRLIAGAHMVIPGARHELLQERDIFR
EPLLAAFDAFIPGSPAPAESKAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccgagatgatcctttacagcaccttcgagaatcccgtgccggaaggcgcgctg
tgcggcaccgtcaccgccgtcgacggcgtgcagctgcgctttgcccgctggccggtggcg
ggcgagtgccggggcacggtctgcgtcttcccgggccgcaccgagaagatcgagaaatac
ttcgagacggtgcgcgacctgctgcgccggggcttcgccgtggcggcgctcgactggcgc
gggcagggcggctcgcagcggctgctgcgcaacccgatgaaggggcatgtgcgcgatttc
gccgaataccagctcgacatcgacgccttcatgcagcaggcggtgacgcccgagctgccc
ggcccctatttcgcgctggcccattcgatgggcgcgaccatcctgctcgaccatgcgcgg
cgcggcggcacgctgttcgagcgcatgttcctgatcgcgccgatgctggatatctcgctg
gtcaagcacgaggcgacggcgcggcgcgcggcgcggctgctcgcccgcctcggcttcggc
aaggcctatgtgccgcgcgggcggcgccggctgcgcgaactgcatttcgacggcaaccgg
ctgacctccgacgccgcgcgcttcgcccgcaacctgaccatcaccatggagcagccgcag
ctcgatgtcggcccgccgaccatcggctggatcaaggcggcctatgacgtgatggagacg
ctcgccgacccggcgacggctcgcaagatccgccagccgctgctgatggtggcggcggga
caggacagcatcgtctcgacccccaccatcgagcatctgggcacgcggctgatcgccggc
gcgcacatggtgatccccggggcgcggcacgaattgctgcaggagcgcgacatcttccgc
gagccgctgctcgccgccttcgacgccttcattcccggcagcccggcgccggcggagagc
aaggcggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system