KEGG   Starkeya novella: Snov_2709Help
Entry
Snov_2709         CDS       T01258                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sno  Starkeya novella
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sno00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2838396..2839367)
Genome map
AA seq 323 aa AA seqDB search
MPSEMILYSTFENPVPEGALCGTVTAVDGVQLRFARWPVAGECRGTVCVFPGRTEKIEKY
FETVRDLLRRGFAVAALDWRGQGGSQRLLRNPMKGHVRDFAEYQLDIDAFMQQAVTPELP
GPYFALAHSMGATILLDHARRGGTLFERMFLIAPMLDISLVKHEATARRAARLLARLGFG
KAYVPRGRRRLRELHFDGNRLTSDAARFARNLTITMEQPQLDVGPPTIGWIKAAYDVMET
LADPATARKIRQPLLMVAAGQDSIVSTPTIEHLGTRLIAGAHMVIPGARHELLQERDIFR
EPLLAAFDAFIPGSPAPAESKAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccgagatgatcctttacagcaccttcgagaatcccgtgccggaaggcgcgctg
tgcggcaccgtcaccgccgtcgacggcgtgcagctgcgctttgcccgctggccggtggcg
ggcgagtgccggggcacggtctgcgtcttcccgggccgcaccgagaagatcgagaaatac
ttcgagacggtgcgcgacctgctgcgccggggcttcgccgtggcggcgctcgactggcgc
gggcagggcggctcgcagcggctgctgcgcaacccgatgaaggggcatgtgcgcgatttc
gccgaataccagctcgacatcgacgccttcatgcagcaggcggtgacgcccgagctgccc
ggcccctatttcgcgctggcccattcgatgggcgcgaccatcctgctcgaccatgcgcgg
cgcggcggcacgctgttcgagcgcatgttcctgatcgcgccgatgctggatatctcgctg
gtcaagcacgaggcgacggcgcggcgcgcggcgcggctgctcgcccgcctcggcttcggc
aaggcctatgtgccgcgcgggcggcgccggctgcgcgaactgcatttcgacggcaaccgg
ctgacctccgacgccgcgcgcttcgcccgcaacctgaccatcaccatggagcagccgcag
ctcgatgtcggcccgccgaccatcggctggatcaaggcggcctatgacgtgatggagacg
ctcgccgacccggcgacggctcgcaagatccgccagccgctgctgatggtggcggcggga
caggacagcatcgtctcgacccccaccatcgagcatctgggcacgcggctgatcgccggc
gcgcacatggtgatccccggggcgcggcacgaattgctgcaggagcgcgacatcttccgc
gagccgctgctcgccgccttcgacgccttcattcccggcagcccggcgccggcggagagc
aaggcggcctga

DBGET integrated database retrieval system