KEGG   Starkeya novella: Snov_2717Help
Entry
Snov_2717         CDS       T01258                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sno  Starkeya novella
Pathway
sno00040  Pentose and glucuronate interconversions
sno00052  Galactose metabolism
sno00500  Starch and sucrose metabolism
sno00520  Amino sugar and nucleotide sugar metabolism
sno01100  Metabolic pathways
sno01130  Biosynthesis of antibiotics
Module
sno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Snov_2717
   00052 Galactose metabolism
    Snov_2717
   00500 Starch and sucrose metabolism
    Snov_2717
   00520 Amino sugar and nucleotide sugar metabolism
    Snov_2717
Enzymes [BR:sno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Snov_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADH90006
JGI: Snov_2717
UniProt: D7A5B8
Position
2851761..2852651
Genome map
AA seq 296 aa AA seqDB search
MVKPIRKAILPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEARAAGIEHIVFVTGR
NKGVIEDHFDRQYELEDTLNERGKTQMLEMLRHETMGPGATSFTRQQLPLGLGHAVWCAR
DIIGNEPFALLLPDMLHKPTNGKGCLAQMAEAYAKTGGGNHIAVYEVPPEQTDQYGIVGL
GDEVAEGVHRIAGMVEKPKKDVAPSNLAISGRYILQPEIFELLATQERGAGNEIQLTDSM
LKLAREQDFYSVTFDGAIYDCGSKLGFLMANVAYALDNPEIADTFRPELDALLAKN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacccattcgcaaggcgatccttcccgtggccggcctcggcacgcgcttcctg
ccggccaccaaggccgtgccgaaggaaatgctcaccgtcgtagaccggcccgtcgtgcag
catgtggtcgacgaggcgcgcgccgccggcatcgagcacatcgtcttcgtgaccggccgc
aacaagggcgtcatcgaagaccatttcgaccggcagtacgagctcgaggacacgctgaac
gagcgcggcaagacgcagatgctggaaatgctgcgccacgagaccatgggtccgggcgcc
accagcttcacccgccagcaattgcccctcggcctcggccatgcggtgtggtgcgcgcgc
gacatcatcggcaacgagcccttcgcgctgctgctgccggacatgctgcacaagccgacc
aacggcaagggctgcctcgcccagatggccgaggcctatgccaagaccggcggcggcaac
cacatcgcggtctacgaggtgccgccggagcagaccgaccagtacggcatcgtcgggctc
ggcgacgaggtggccgagggcgtgcacaggatcgccggcatggtggagaagccgaagaag
gacgtcgccccctccaacctcgccatttccggccgctacatcctgcagccggagatcttc
gaattgctggccacgcaggagcgcggcgccggcaacgagatccagctcaccgattccatg
ctcaagctggcgcgggagcaggatttctacagcgtgaccttcgacggcgcgatctacgat
tgcggctcgaagctcggcttcctgatggcgaacgtcgcctatgcgctcgacaatccggag
atcgccgacaccttccggcccgagctcgacgcgctgctggcaaagaactga

DBGET integrated database retrieval system