KEGG   Starkeya novella: Snov_2717Help
Entry
Snov_2717         CDS       T01258                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sno  Starkeya novella
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Snov_2717
   00052 Galactose metabolism
    Snov_2717
   00500 Starch and sucrose metabolism
    Snov_2717
   00520 Amino sugar and nucleotide sugar metabolism
    Snov_2717
Enzymes [BR:sno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Snov_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2851761..2852651
Genome map
AA seq 296 aa AA seqDB search
MVKPIRKAILPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEARAAGIEHIVFVTGR
NKGVIEDHFDRQYELEDTLNERGKTQMLEMLRHETMGPGATSFTRQQLPLGLGHAVWCAR
DIIGNEPFALLLPDMLHKPTNGKGCLAQMAEAYAKTGGGNHIAVYEVPPEQTDQYGIVGL
GDEVAEGVHRIAGMVEKPKKDVAPSNLAISGRYILQPEIFELLATQERGAGNEIQLTDSM
LKLAREQDFYSVTFDGAIYDCGSKLGFLMANVAYALDNPEIADTFRPELDALLAKN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacccattcgcaaggcgatccttcccgtggccggcctcggcacgcgcttcctg
ccggccaccaaggccgtgccgaaggaaatgctcaccgtcgtagaccggcccgtcgtgcag
catgtggtcgacgaggcgcgcgccgccggcatcgagcacatcgtcttcgtgaccggccgc
aacaagggcgtcatcgaagaccatttcgaccggcagtacgagctcgaggacacgctgaac
gagcgcggcaagacgcagatgctggaaatgctgcgccacgagaccatgggtccgggcgcc
accagcttcacccgccagcaattgcccctcggcctcggccatgcggtgtggtgcgcgcgc
gacatcatcggcaacgagcccttcgcgctgctgctgccggacatgctgcacaagccgacc
aacggcaagggctgcctcgcccagatggccgaggcctatgccaagaccggcggcggcaac
cacatcgcggtctacgaggtgccgccggagcagaccgaccagtacggcatcgtcgggctc
ggcgacgaggtggccgagggcgtgcacaggatcgccggcatggtggagaagccgaagaag
gacgtcgccccctccaacctcgccatttccggccgctacatcctgcagccggagatcttc
gaattgctggccacgcaggagcgcggcgccggcaacgagatccagctcaccgattccatg
ctcaagctggcgcgggagcaggatttctacagcgtgaccttcgacggcgcgatctacgat
tgcggctcgaagctcggcttcctgatggcgaacgtcgcctatgcgctcgacaatccggag
atcgccgacaccttccggcccgagctcgacgcgctgctggcaaagaactga

DBGET integrated database retrieval system