KEGG   Starkeya novella: Snov_2737Help
Entry
Snov_2737         CDS       T01258                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sno  Starkeya novella
Pathway
sno00071  Fatty acid degradation
sno00072  Synthesis and degradation of ketone bodies
sno00280  Valine, leucine and isoleucine degradation
sno00310  Lysine degradation
sno00362  Benzoate degradation
sno00380  Tryptophan metabolism
sno00620  Pyruvate metabolism
sno00630  Glyoxylate and dicarboxylate metabolism
sno00640  Propanoate metabolism
sno00650  Butanoate metabolism
sno00900  Terpenoid backbone biosynthesis
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
sno01130  Biosynthesis of antibiotics
sno01200  Carbon metabolism
sno01212  Fatty acid metabolism
sno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snov_2737
   00630 Glyoxylate and dicarboxylate metabolism
    Snov_2737
   00640 Propanoate metabolism
    Snov_2737
   00650 Butanoate metabolism
    Snov_2737
  Lipid metabolism
   00071 Fatty acid degradation
    Snov_2737
   00072 Synthesis and degradation of ketone bodies
    Snov_2737
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Snov_2737
   00310 Lysine degradation
    Snov_2737
   00380 Tryptophan metabolism
    Snov_2737
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Snov_2737
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Snov_2737
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Snov_2737
Enzymes [BR:sno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Snov_2737
Exosome [BR:sno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Snov_2737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADH90026
JGI: Snov_2737
UniProt: D7A5R1
Position
complement(2873014..2874186)
Genome map
AA seq 390 aa AA seqDB search
MKDDIVIVGAARTAVGAFNGALSSLPAHELGKVAIGAALERAGVEPGAVSETIMGQILTA
GAGQNPARQASVAAGIPVESPAWGVNQLCGSGLRAVALGYQALLNGDSDIVVAGGQESMS
QAPHCAHLRNGTKMGDLQMVDTMIKDGLWDAFNGYHMGTTAENVARQWQITREQQDEFAV
RSQNKAEAAQKAGRFKDEIVPVTISTRKGDIIVADDEYPRHGATLDGMTKLRPAFSKDGT
VTAGNASGINDGAAAVVLMTAAKAAGRKPLARIVSWAQAGVDPSIMGSGPIPASRRALEK
AGWTVADLDLIEANEAFAAQACAVNKDLGWDPAKVNVNGGAIALGHPIGASGARILTTLL
YEMEKRDAKKALATLCIGGGMGIAMCLERD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgacatcgtcatcgtcggcgccgcacgcacggctgtcggcgcgttcaacggc
gcgctctcctcgctgccggcgcatgagctcggcaaggtcgcgatcggcgcggcgctggaa
cgcgcgggggttgaacccggcgcggtcagcgagacgatcatgggccagatcctcaccgcc
ggcgcggggcagaacccggcgcggcaggcctccgtcgccgccggcatcccggtggaaagc
ccggcctggggcgtcaaccagctctgcggctcgggcctgcgggcggtcgccctcggctac
caggcgctgctcaacggcgacagcgatatcgtcgtcgcgggcggccaggaatcgatgagc
caggcgccgcactgcgcgcatctgcgcaacggcaccaagatgggcgacctgcagatggtc
gacaccatgatcaaggacggcctgtgggacgccttcaacggctaccacatgggcacgacc
gccgagaacgtcgcgcgccagtggcagatcacccgcgagcagcaggacgagttcgcggtc
cgctcgcagaacaaggccgaggcggcgcagaaggccggccgcttcaaggacgagatcgtc
cctgtcaccatctccacccgcaagggcgacattatcgtcgccgacgacgagtatccccgc
cacggcgccacgctcgacggcatgaccaagctgcgcccggccttctccaaggacggcacg
gtgaccgccggcaacgcctccggcatcaatgacggcgccgccgccgtggtgctgatgacc
gccgccaaggctgcgggccgcaagccgctggcgcgcatcgtctcctgggcgcaggcgggc
gtcgacccgtccatcatgggctccggcccgatcccggcctcgcgccgcgcgctggagaag
gcgggctggaccgtcgccgacctcgacctgatcgaggccaacgaggccttcgccgcgcag
gcctgcgcggtgaacaaggacctcggctgggatccggccaaggtgaacgtcaacggcggc
gccattgcgctgggccacccgatcggcgcctccggcgcgcgcatcctcaccacgctgctc
tacgagatggagaagcgcgacgccaagaaggcgctcgccacgctgtgcatcggcggcggc
atgggcatcgccatgtgcctggaacgcgactga

DBGET integrated database retrieval system