KEGG   Starkeya novella: Snov_2810Help
Entry
Snov_2810         CDS       T01258                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sno  Starkeya novella
Brite
Enzymes [BR:sno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Snov_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2941667..2943193
Genome map
AA seq 508 aa AA seqDB search
MDISSNCLDLIREFEGLRLKAYIDPVGIPTIGYGTIRYPNGTTVQMGDSISEAEAEAFLC
FECEEIGRKLREVLDQVALSQNQYDAIVSFCFNLGVGAFAGSTLLQKLRLGDVPAAAAEF
PRWNKGTVDGVKQELPGLTRRRARERSLFEAGGHGGTPLQPSPPSPQEQVVRVAGYREGA
ANIIVGFGADGAARDIVELADAHPETLIAALQSYPKLHAFEFAAPGETVPAGERTRFSGL
ALPLPRTKGAPKLDRPLLLVGMEDDEENPGKDIAEMQARLVELGYYRGPVDGIFNPATDA
AVREFQTEFFGWSEADGRVGPKTWKKLWGDAPPKPEEAIPPLQGSAGKTYLLLTRTDRRD
RYGCMVMNLTYVRHGTAVGVLEVCSGQSRKQIFRPGPHSPAGSMEPLPEGKWSIGNIEWA
EGKDNYSGRIYNNGLGPAKIRMEYLDPGQTPRSAIEIHIDWNRPTAPGTAGCIGIQNISD
FRTLVTWLRETDPKELFVDWGLGTCPHP
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacatttcttcgaattgcctcgacctgatccgggaattcgagggcctcagactcaag
gcctatatcgatcccgtcggcatcccgaccatcggctacggcaccatacgctatcccaac
ggcaccacggtgcagatgggcgacagcatctccgaggcggaggcggaagccttcctgtgc
ttcgaatgcgaggaaatcggccgcaagctgcgcgaggtgctcgatcaggtcgcgctgagc
cagaaccagtacgacgcgatcgtctcgttctgcttcaatctgggcgtcggcgccttcgcc
ggcagcacgctcctgcagaagctgcggttgggcgacgtgcccgctgccgccgccgagttc
ccgcgctggaacaagggcacggtcgacggcgtcaagcaggagctgccggggctcacccgc
cgccgcgccagagaacgcagcctgttcgaggccggcgggcatggcggcaccccgctccag
ccctcgccgccctcgccgcaggagcaggtggtccgcgtggccggctaccgcgaaggtgcg
gccaacatcatcgtcggcttcggcgcggacggcgccgcgcgcgacatcgtcgagctggcc
gatgcccatcccgagacgctgatcgcggcgctgcaaagctatccgaagctccatgccttc
gaattcgccgcgccgggcgagaccgttcccgccggggagcggacgcgcttctccggcctc
gccctgccgctgcctcggacgaagggcgcgcccaagctcgaccgccccctgctgctcgtc
ggcatggaggacgacgaggagaacccgggcaaggacatcgccgagatgcaggcccggctg
gtcgagctcggctattaccgggggccggtcgacggcatcttcaacccggcgacggatgcc
gccgtccgcgagttccagacggagttcttcggctggagcgaagcggacgggcgggtcggg
ccgaagacctggaagaagctctggggcgacgcgccgcccaagcccgaggaggcgatcccg
ccgctgcagggctcggccggcaagacctatctgctgctgacccggaccgaccgccgcgac
cgctatggctgcatggtgatgaacctcacctatgtccgccacggcaccgccgtcggcgtg
ctggaggtctgctccggccagtcgcgcaagcagatcttccggcccgggccgcacagcccg
gccggctcgatggagccgctgccggaaggcaagtggagcatcggcaacatcgaatgggcc
gaaggcaaggacaactatagcggccgcatctacaataacgggctaggcccggccaagatc
aggatggaatatctcgatcccggccagacgccgcgctcggccatcgagatccatatcgac
tggaaccgcccgaccgcgccgggcacggcgggatgcatcggcatccagaatatctccgac
ttcaggacgctggtgacgtggctgcgcgagaccgacccgaaggagctgttcgtcgattgg
gggctgggcacctgcccgcacccctga

DBGET integrated database retrieval system