KEGG   Starkeya novella: Snov_2818Help
Entry
Snov_2818         CDS       T01258                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sno  Starkeya novella
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snov_2818
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snov_2818
   00052 Galactose metabolism
    Snov_2818
   00500 Starch and sucrose metabolism
    Snov_2818
   00520 Amino sugar and nucleotide sugar metabolism
    Snov_2818
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Snov_2818
   00524 Butirosin and neomycin biosynthesis
    Snov_2818
Enzymes [BR:sno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Snov_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2957420..2958391
Genome map
AA seq 323 aa AA seqDB search
MPHLILIADIGGTSSRLAVVDTDGVPRDIQIHRNDDFAGFKELIAADLDQRGPGARTAVG
GAVLAVAGPADQESVKLTNRDWGFTKRDMRKHFGWQKFAAVNDFEALAHGVPALGASDLV
PVGGGLAEPGAPMLVCGPGTGFGVAGIVKIAGRHHAITGEGGRARLGAADAEEALLLGHL
VRELGPVVVEHALSGSGLARIHRILAGAALTPEAVIAAAKAGDEAARETCNVFLKLFGRI
AGDLALIVNARGGVYLAGGVSAGLAPFFAESPFRAMFEEHPPHGPRLVATPVNIITHPTP
GLIGCGQLGARLARSLKPGLHVV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccccatctcatcctgatcgccgatatcggcggaacctcctcccgcctcgccgtcgtc
gacacggacggcgtgccgcgcgacatccagatccaccgcaatgacgacttcgccggcttc
aaggagctgatcgcggccgacctcgaccagcgcggccccggcgcacgcacggcggtcggc
ggcgccgtccttgccgtggccgggccagccgaccaggagagcgtgaagctcaccaaccgc
gactggggcttcaccaagcgcgacatgcgcaagcatttcggctggcagaaattcgccgcg
gtgaacgatttcgaggcgctcgcccatggcgtgccggcgctcggcgcttccgacctcgtg
ccggtcggcggcggccttgccgagccgggcgcgccgatgttggtctgcggccccggcacc
ggcttcggcgtcgccggcatcgtcaagatcgccggccgccaccacgccatcaccggcgaa
ggcggccgcgcccgcctcggcgccgcggatgccgaggaggcgctgctgctcggccatctg
gtgcgcgagctcggccccgtcgtggtggagcatgcgctgtcgggctcgggcctcgcccgc
atccaccgcatcctcgccggcgccgcgctgacacccgaggcggtgatcgccgccgccaag
gcgggtgacgaggccgcgcgcgagacctgcaacgtattcctgaagctgttcggccgcatc
gccggcgacctcgcgctcatcgtcaatgcgcgcggcggcgtctatctcgccggcggcgtc
tcggcggggctggcgccgttcttcgcggaatcgcccttccgcgccatgttcgaggagcac
ccgccgcacgggccgcgcctcgtcgccacgccggtcaacatcatcacccacccgacgccg
ggcctgatcggctgcggccaactcggcgcgcggctcgcccgcagcctcaagcccggcctg
cacgtcgtgtga

DBGET integrated database retrieval system