KEGG   Starkeya novella: Snov_2988Help
Entry
Snov_2988         CDS       T01258                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sno  Starkeya novella
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Snov_2988
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snov_2988
   00640 Propanoate metabolism
    Snov_2988
   00660 C5-Branched dibasic acid metabolism
    Snov_2988
Enzymes [BR:sno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Snov_2988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3122960..3124159
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKGVLREYGVPVPNGVAILDAAEADAAAAKIPGPVWVVKSQIHAGGRGKGKFK
EADAGEKGGVRVVKSAGEAAANAKQILGKTLVTVQTGPAGKQVNRVYIEEGSDIDKEFYL
SALVDRATSRVAFVVSTEGGMDIEEVAHSTPEKIHTFSIDPATGVMPHHGRTVAQALGLS
GDLAKQAGNLVTKLYAAFVGKDMAMLEVNPLVVTKGGELKCLDAKISFDSNSLYRHPDVV
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGESPANFLDVG
GGATEEKVTAAFKIITADPQVQGILVNIFGGIMKCDVIARGVIAAVKAVGLQVPLVVRLE
GTNVEEGKQIIRDSGLNVIPADDLDDAAQKIVKAVKEAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgagtatcaggccaagggagtgctccgcgaatacggggtcccggtgccg
aacggcgtcgccattctcgacgcggccgaggccgacgccgcggcggcgaagattcccggc
ccggtctgggtcgtgaagagccagatccacgccggcggacgcggcaagggcaagttcaag
gaagccgatgcgggcgagaagggtggcgtgcgcgtcgtcaagtccgccggcgaggctgcc
gccaatgccaagcagatcctcggcaagaccctggtgaccgtgcagaccggcccggccggc
aagcaggtgaaccgcgtctacatcgaggaaggctccgacatcgacaaggagttctacctc
tccgccctcgtcgaccgcgccacctcgcgcgtcgccttcgtcgtctcgaccgaaggcggc
atggacatcgaggaagtcgcccactcgacgcccgagaagatccacaccttctccatcgac
ccggcgaccggcgtgatgccccatcacggccgcaccgtcgcgcaggcgctcggcctgtcc
ggcgacctcgccaagcaggcgggcaacctcgtcaccaagctctatgccgccttcgtcggc
aaggacatggcgatgctcgaggtcaacccgctggtcgtcaccaagggtggcgagctgaag
tgccttgacgccaagatctccttcgattccaactcgctctaccgccacccggacgtggtc
gcgctgcgcgacgagaccgaggaggacgccaaggagatcgaggcgtccaagtacgacctc
gcctatatcgcgctcgatggtaccattggctgcatggtcaacggcgccggcctggccatg
gcgacgctcgacatcatcaagctctatggcgagagcccggccaacttcctcgacgtcggt
ggcggcgccacggaggagaaggtcactgcggcgttcaagatcatcaccgccgacccgcag
gtgcagggcatcctggtcaacatcttcggcggcatcatgaagtgcgacgtcatcgcccgc
ggcgtcatcgccgcggtgaaggcggtcggcctgcaggtgcccctcgtggtgcgcctcgaa
ggcaccaatgtcgaggaaggcaagcagatcatccgcgactcggggctgaacgtcatcccg
gcggacgatctcgacgacgccgcccagaagatcgtcaaggccgtgaaggaggctgcgtga

DBGET integrated database retrieval system