KEGG   Starkeya novella: Snov_3172Help
Entry
Snov_3172         CDS       T01258                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
sno  Starkeya novella
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3326039..3327091
Genome map
AA seq 350 aa AA seqDB search
MIRRVLAGFLLIVCGALPVSAQPSTLIPTEAWSAYMERFVDGSGRVVDTANGGISHSEGQ
GYGMLLAYLAGDRSNFERIWSFTRTELLIRDDGLAAWRWDPNSTPHVTDVNAASDGDLLI
AYALARAGAAWNQQPYIDAARRIARAIGRKLLVTDGSRLVLLPGVSGFSSSDRPDGPILN
LSYWIFETFPVMAQLAPEFKWSEAANAGLELLSIAQLGPARLPPDWISAPASKPVTVAEG
FPPVFGYNSLRISLYLLRAGIENTALQEPFRRSWLIEGGGTPAVVDIPTGRVLARLTDPG
YRMLASVLACALNATPIPEDLRRFEPTLYYPSTLYLLGWALVAERYPRCL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgatccggcgggtgctcgccggctttctcctgatcgtctgcggagcactgcccgtgtcc
gcccagccctccaccctgatcccgaccgaggcctggagcgcctatatggagcgcttcgtc
gacggcagcggacgcgtcgtcgacaccgccaatggcggcatcagccacagcgaaggccag
ggctacggcatgctgctggcgtatttagcaggtgacagaagcaactttgaacgcatatgg
agttttacgcgtaccgagttactgattcgcgatgatggactcgccgcatggcgctgggat
ccgaactctacgccgcatgtcaccgacgtaaacgcggcgagcgacggcgatttgttaatc
gcctatgccttggcacgggccggagccgcgtggaatcaacagccctacatcgacgcggcg
cggcgaatcgcacgggcgatcgggaggaagcttctggtcaccgacggaagccggctggtt
ctgcttccgggcgtctccggcttctcctccagcgaccggccggacggcccgatactcaac
ctatcctattggatattcgagacctttccggtcatggcgcagctcgcgccggagttcaaa
tggtcagaagcggccaatgccgggctggagctgctgagcatcgcccagctgggtccggcg
cggcttccacccgactggatctcggcgccggcgagcaagccggtgacggtcgccgagggc
ttcccgcctgtctttggttacaattcattaaggatatctctttacctgttgcgggcaggg
atcgagaacacggcgttacaggaaccattccggcggagttggctgatcgaaggcgggggc
acacccgcggtcgtcgacatccccaccgggcgcgtgctcgcacggcttaccgacccgggc
tatcgcatgctcgcgtcggttctggcctgtgcgttgaatgccaccccgattcccgaagat
ctgagacgttttgagcctacgctctactatccgtcgacgttgtacttgttaggctgggca
ctggtcgcggagcgatatccgagatgtctttga

DBGET integrated database retrieval system