KEGG   Starkeya novella: Snov_3187Help
Entry
Snov_3187         CDS       T01258                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sno  Starkeya novella
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sno00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:sno00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3346190..3348562
Genome map
AA seq 790 aa AA seqDB search
MPAEPTPMLSPDLATRMNAWWRAANYLSVGQIYLLANPLLREKLTLDHVKPRLLGHWGTT
PGLNFIYVHLNRVINDTGTEVLFIAGPGHGAPGVVAATYLEGTYSELYPDVSQDEAGLCR
LFRQFSFPGGIPSHAAPETPGSIHEGGELGYSLSHAYGAVLDNPDLIVACVVGDGEAETG
PLATSWHGNKFLNPAADGAVLPILHLNGYKIANPTVLARISPEELKSLMEGFGYAPIFVE
GDEPEAMHQIMAAALDKAFADIRAIQKAARTGGNTERPRWPMIVLRSPKGWTGPKTVDGK
KAEGFWRSHQVPFSDMSKPEHLTLLEEWMKSYKPEELFDEAGRLRPEIASLSPAGEKRMS
ANPHANGGALRRPLRLPDFTDYAVKVPHPGDVELESTYIMGTFLRDVMTANAQAKNFRVF
GPDETASNRLQALFEVTNRAWNAEELSYDDHLARDGRVMEMLSEHMCQGWLEGYLLTGRH
GLFSCYEAFIHIVDSMFNQHAKWLKSSKEVEWRRPIASLNYLLTSHVWRQDHNGFSHQDP
GFIDHVVNKKADVVRVYLPPDANTLLWVTDHCLKSWNRVNVIVAGKQPAPQWLDMDAAIK
HCAAGIGTWEWASTDEGVDPDVVLACAGDVPTLETLAAADLLRGYFPDLKVRVVNVVDLM
TLQPKSEHPHGLSDADFDALFTKDKPIIFAYHGYPWLIHRLAYRRTNHANMHVRGYIEEG
STTTPFDMVVRNRLDRFHLVADVIERVPKLSGNVHVRQDIRDKLTEHARYIRAHGLDMPE
VRDWRWPGGA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgagccgacccccatgctgagccccgatctcgccacccgcatgaacgcctgg
tggcgcgcggcgaactatctctcggtcggccagatctacctgctcgccaacccgctgctg
cgcgagaagctcaccctcgaccacgtcaagccgcgcctgctcggccattggggcacgacg
ccggggctgaacttcatctatgtccacctcaaccgcgtcatcaacgacaccggtaccgag
gtgctgttcatcgccggccccggccatggcgcaccgggcgtggtggcagcgacctatctg
gaaggcacctattccgagctctacccggacgtgtcgcaggacgaggccggcctgtgccgg
ctgttccggcagttctccttccccggcggcattcccagccacgcggcgccggaaacgccc
ggctcgatccatgagggcggtgagctcggctattcgctcagccatgcctatggcgcggtg
ctggacaatccggacctgatcgtcgcctgcgtggtcggcgacggcgaggcggagaccggc
ccgctcgccacctcctggcacggcaacaagttcctcaacccggcggccgatggcgcggtg
ctgccgatcctgcacctcaacggctacaagatcgccaacccgaccgtgctcgcccgcatc
tcgccggaagagctgaaaagcctgatggagggcttcggctacgccccgatcttcgtcgag
ggcgacgagccggaggcgatgcaccagatcatggcggcggcgctcgacaaggctttcgcc
gacatccgcgccatccagaaggccgcgcgcacgggtgggaacaccgagcgcccgcgctgg
ccgatgatcgtgctgcgttcgcccaagggctggaccggcccgaagacggtcgacggcaag
aaggccgagggcttctggcgctcgcaccaggtgccgttctccgacatgtcgaagcccgag
cacctgaccctgctcgaagagtggatgaagagctacaagcccgaggagctgttcgacgag
gcggggcgcctgcgtcccgagatcgcctcgctctcgcccgccggcgagaagcgcatgagc
gccaacccgcacgccaatggcggcgccctgcgccggccgctgcgtttgcccgacttcacc
gactacgcggtgaaggtgccgcatcccggcgacgtcgagctggaatcgacctacatcatg
ggcaccttcctgcgcgacgtgatgacggcgaatgcgcaggcgaagaacttccgcgtcttc
ggtccggatgagaccgcctccaaccggctgcaggcgctgttcgaggtcaccaaccgcgcc
tggaacgcggaggagctctcctatgacgaccacctcgcccgcgacgggcgggtgatggag
atgttgtccgagcacatgtgccagggctggctggagggctacctcctcaccggccggcac
gggctgttctcctgctacgaggcgttcatccacatcgtcgattcgatgttcaaccagcac
gccaaatggctgaagtcctcgaaggaggtggagtggcgccggcccatcgcctcgctcaac
tacctcctcacctcgcatgtctggcggcaggaccataacggcttcagccaccaggacccc
ggcttcatcgaccatgtggtgaacaagaaggcggacgtcgtccgcgtttacctgccgccg
gacgccaacacgctgctctgggtcaccgaccactgcctgaagagctggaaccgcgtgaac
gtcatcgtcgccggcaagcagccggcaccgcaatggctcgacatggacgcggcgatcaag
cactgcgccgccggtatcggcacctgggaatgggcgagcacggatgagggcgtcgacccc
gacgtggtgctcgcctgcgccggcgatgtcccgacattggaaacgctcgctgccgccgac
ctgctgcgcggctacttccccgatctcaaggtacgggtggtcaacgtcgtcgacctgatg
acgctgcagccgaaatccgagcacccgcacgggctgtcagacgccgatttcgacgcgctg
ttcaccaaggacaagccgatcatcttcgcctatcacggctatccttggctcatccaccgc
ctcgcctatcgccgcaccaaccatgccaacatgcatgtgcgcggctatatcgaggaaggc
tcgaccaccacgcccttcgacatggtggtgcgcaaccggctcgaccgcttccacctcgtc
gccgacgtgatcgagcgcgtgccgaagctctcgggcaatgtgcatgtgcggcaggacatc
cgcgacaagctcaccgagcacgcgcgctacatccgcgcgcatgggctcgacatgccggag
gtgcgcgactggcgctggccgggcggggcgtga

DBGET integrated database retrieval system